OSCAR Protein, Human (HEK293, His)
OSCAR Protein, a key orchestrator in bone biology, crucially regulates osteoclastogenesis, influencing osteoclast differentiation, formation, and maturation. Focused on bones, OSCAR plays a pivotal role in maintaining skeletal homeostasis and structural integrity, contributing to the dynamic equilibrium of bone remodeling. OSCAR Protein, Human (HEK293, His) is the recombinant human-derived OSCAR protein, expressed by HEK293, with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
OSCAR Protein, a key orchestrator in bone biology, crucially regulates osteoclastogenesis, influencing osteoclast differentiation, formation, and maturation. Focused on bones, OSCAR plays a pivotal role in maintaining skeletal homeostasis and structural integrity, contributing to the dynamic equilibrium of bone remodeling. OSCAR Protein, Human (HEK293, His) is the recombinant human-derived OSCAR protein, expressed by HEK293, with C-His labeled tag.
Background
OSCAR, a key orchestrator in bone biology, emerges as a crucial regulator of osteoclastogenesis, wielding significant influence in the intricate process of osteoclast differentiation. With a bone-specific focus, OSCAR exerts its regulatory prowess to fine-tune the mechanisms governing the formation and maturation of osteoclasts. Through its pivotal role in osteoclastogenesis, OSCAR contributes to the dynamic equilibrium of bone remodeling, playing a crucial part in maintaining skeletal homeostasis and structural integrity.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
Q8IYS5-2 (D19-N229)
-
Gene ID126014
-
Molecular Construction
-
N-term
-
OSCAR (D19-N229)
Accession # Q8IYS5-2 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
OSCAR; Osteoclast Associated Receptor OSCAR-S1; Osteoclast Associated Ig-Like Receptor; Osteoclast Associated Receptor OSCAR-S2; Osteoclast Associated, Immunoglobulin-Like Receptor; Osteoclast-Associated Receptor; Osteoclast-Associated Immunoglobulin-Like
-
AA Sequence
DITPSVPPASYHPKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFKPGEIAPLLFRDVSSELAEFFLEEVTPAQGGIYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALPGPVVGPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWEDSGSSDYTRGN
-
Predicted Molecular Mass
25 kDa
-
Molecular Weight
Approximately 33-43 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
