OSCAR Protein, Human (HEK293, His)

OSCAR Protein, a key orchestrator in bone biology, crucially regulates osteoclastogenesis, influencing osteoclast differentiation, formation, and maturation. Focused on bones, OSCAR plays a pivotal role in maintaining skeletal homeostasis and structural integrity, contributing to the dynamic equilibrium of bone remodeling. OSCAR Protein, Human (HEK293, His) is the recombinant human-derived OSCAR protein, expressed by HEK293, with C-His labeled tag.

OSCAR, a key orchestrator in bone biology, emerges as a crucial regulator of osteoclastogenesis, wielding significant influence in the intricate process of osteoclast differentiation. With a bone-specific focus, OSCAR exerts its regulatory prowess to fine-tune the mechanisms governing the formation and maturation of osteoclasts. Through its pivotal role in osteoclastogenesis, OSCAR contributes to the dynamic equilibrium of bone remodeling, playing a crucial part in maintaining skeletal homeostasis and structural integrity.

Human

HEK293

C-His

Q8IYS5-2 (D19-N229)

126014

Partial

DITPSVPPASYHPKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFKPGEIAPLLFRDVSSELAEFFLEEVTPAQGGIYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALPGPVVGPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWEDSGSSDYTRGN

Approximately 33-43 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.