OSCAR Protein, Human (HEK293, His)

OSCAR Protein, a key orchestrator in bone biology, crucially regulates osteoclastogenesis, influencing osteoclast differentiation, formation, and maturation. Focused on bones, OSCAR plays a pivotal role in maintaining skeletal homeostasis and structural integrity, contributing to the dynamic equilibrium of bone remodeling. OSCAR Protein, Human (HEK293, His) is the recombinant human-derived OSCAR protein, expressed by HEK293, with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

OSCAR Protein, a key orchestrator in bone biology, crucially regulates osteoclastogenesis, influencing osteoclast differentiation, formation, and maturation. Focused on bones, OSCAR plays a pivotal role in maintaining skeletal homeostasis and structural integrity, contributing to the dynamic equilibrium of bone remodeling. OSCAR Protein, Human (HEK293, His) is the recombinant human-derived OSCAR protein, expressed by HEK293, with C-His labeled tag.

Background

OSCAR, a key orchestrator in bone biology, emerges as a crucial regulator of osteoclastogenesis, wielding significant influence in the intricate process of osteoclast differentiation. With a bone-specific focus, OSCAR exerts its regulatory prowess to fine-tune the mechanisms governing the formation and maturation of osteoclasts. Through its pivotal role in osteoclastogenesis, OSCAR contributes to the dynamic equilibrium of bone remodeling, playing a crucial part in maintaining skeletal homeostasis and structural integrity.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • OSCAR (D19-N229)
      Accession # Q8IYS5-2
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    OSCAR; Osteoclast Associated Receptor OSCAR-S1; Osteoclast Associated Ig-Like Receptor; Osteoclast Associated Receptor OSCAR-S2; Osteoclast Associated, Immunoglobulin-Like Receptor; Osteoclast-Associated Receptor; Osteoclast-Associated Immunoglobulin-Like

  • AA Sequence

    DITPSVPPASYHPKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFKPGEIAPLLFRDVSSELAEFFLEEVTPAQGGIYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALPGPVVGPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWEDSGSSDYTRGN

  • Predicted Molecular Mass

    25 kDa

  • Molecular Weight

    Approximately 33-43 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00