OTUD6B Protein, Human (Active, Flag)
OTUD6B Protein, Human (Active, Flag) is the recombinant human-derived OTUD6B, expressed by E. coli , with Flag labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
OTUD6B Protein, Human (Active, Flag) is the recombinant human-derived OTUD6B, expressed by E. coli , with Flag labeled tag. ,
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Flag
-
Accession
A0A087X0W9 (E2-S323)
-
Gene ID51633
-
Protein Length
Full Length
-
Synonyms
OTUD6B; OTU Domain Containing 6B; OTU Deubiquitinase 6B; Deubiquitinase OTUD6B; DUBA5; DUBA-5; CGI-77; Ubiquitinyl Hydrolase 1; OTU Domain-Containing Protein 6B; IDDFSDA
-
AA Sequence
EPRVRVEGWKVPTSRCRFLLARVLGYLVVMEAVLTEELDEEEQLLRRHRKEKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEKEMEQKHREELEQLKLTTKENKIDSVAVNISNLVLENQPPRISKAQKRREKKAALEKEREERIAEAEIENLTGARHMESEKLAQILAARQLEIKQIPSDGHCMYKAIEDQLKEKDCALTVVALRSQTAEYMQSHVEDFLPFLTNPNTGDMYTPEEFQKYCEDIVNTAAWGGQLELRALSHILQTPIEIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNSVTRLVNIVTENCS
-
Predicted Molecular Mass
38.4 kDa
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)