Outer membrane porin C/OmpC Protein, E.coli (His-SUMO)

Outer membrane porin C (OmpC) functions as a channel, creating pores that facilitate passive diffusion of small molecules across the bacterial outer membrane. In the context of microbial infection, OmpC plays a role in supporting the entry of colicin E5 even in the absence of its primary receptor OmpF. Outer membrane porin C/OmpC Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Outer membrane porin C/OmpC protein, expressed by E. coli , with N-His, N-SUMO labeled tag. The total length of Outer membrane porin C/OmpC Protein, E.coli (His-SUMO) is 346 a.a., with molecular weight of ~54.3 kDa.

The Outer membrane porin C (OmpC) protein is a vital component of bacterial outer membranes, forming pores that facilitate the passive diffusion of small molecules. This porin is essential for the uptake of nutrients and other substances by the bacterial cell. Notably, OmpC plays a role in microbial infection, acting as a gateway for the entry of various molecules. Additionally, OmpC demonstrates functional versatility by supporting the entry of colicin E5, a bacteriocin, in the absence of its major receptor OmpF. This suggests that OmpC can serve as an alternative route for the internalization of specific substances, highlighting its adaptability and importance in bacterial membrane dynamics and defense mechanisms.

E.coli

E. coli

N-His;N-SUMO

P06996 (22A-367F)

946716  [NCBI]

AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF

Approximately 54.3 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in Tris-based buffer, 50% glycerol.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.