OV16 Protein, Onchocerca volvulus (Biotinylated, HEK293, Avi-GST)
The OV16 protein is a phosphatidylethanolamine-binding protein found in the subcutaneous tissue, stratum corneum, and uterus and has been shown to be involved in multiple physiological functions, possibly related to structural integrity and reproduction. It belongs to the phosphatidylethanolamine-binding protein family, suggesting a role in lipid processes or signaling. OV16 Protein, Onchocerca volvulus (Biotinylated, HEK293, Avi-GST) is the recombinant OV16 protein, expressed by HEK293 , with N-Avi, N-GST labeled tag. The total length of OV16 Protein, Onchocerca volvulus (Biotinylated, HEK293, Avi-GST) is 181 a.a., with molecular weight of 46-50 kDa.
- Species: Others
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The OV16 protein is a phosphatidylethanolamine-binding protein found in the subcutaneous tissue, stratum corneum, and uterus and has been shown to be involved in multiple physiological functions, possibly related to structural integrity and reproduction. It belongs to the phosphatidylethanolamine-binding protein family, suggesting a role in lipid processes or signaling. OV16 Protein, Onchocerca volvulus (Biotinylated, HEK293, Avi-GST) is the recombinant OV16 protein, expressed by HEK293 , with N-Avi, N-GST labeled tag. The total length of OV16 Protein, Onchocerca volvulus (Biotinylated, HEK293, Avi-GST) is 181 a.a., with molecular weight of 46-50 kDa.
Background
OV16 Protein, a member of the phosphatidylethanolamine-binding protein family, is localized in the hypodermis, cuticle, and uterus. This protein's distribution across these cellular structures suggests its involvement in diverse physiological functions, potentially related to structural integrity and reproductive processes. The designation within the phosphatidylethanolamine-binding protein family hints at its putative role in lipid-related processes or cellular signaling. The specific localization in the hypodermis and cuticle may imply functions related to structural support or protection, while its presence in the uterus suggests a potential role in reproductive biology or embryonic development. The broader implications of OV16 Protein within these cellular contexts underscore its significance in various aspects of cellular and organismal biology.
Technical Parameters
-
Species Others
-
Source HEK293
-
Tag N-Avi;N-GST
-
Accession
P31729 (K17-D197)
-
Gene ID/
-
Protein Length
Full Length of Mature Protein
-
Conjugation
Biotin
-
Synonyms
OV-16 antigen; OV16
-
AA Sequence
KISAENANCKKCTPMLVDSAFKEHGIVPDVVSTAPTKLVNVSYNNLTVNLGNELTPTQVKNQPTKVSWDAEPGALYTLVMTDPDAPSRKNPVFREWHHWLIINISGQNVSSGTVLSDYIGSGPRKGTGLHRYVFLVYKQPGSITDTQHGGNRRNFKVMDFANKHHLGNPVAGNFFQAKHED
-
Predicted Molecular Mass
48.8 kDa
-
Molecular Weight
Approximately 46-50 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
