PAK3 Protein, Human (Active, sf9, GST)
PAK3 is a serine/threonine kinase that plays a key role in multiple signaling pathways, affecting cytoskeletal dynamics, cell migration, and cell cycle. Its involvement in dendritic spine morphogenesis and synapse formation emphasizes its importance in neuronal processes. PAK3, Human (Active, sf9, GST) is the recombinant human-derived PAK3 protein, expressed by sf9 insect cells, with N-Avi labeled tag.
- Species: Human
- Source: sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
PAK3 is a serine/threonine kinase that plays a key role in multiple signaling pathways, affecting cytoskeletal dynamics, cell migration, and cell cycle. Its involvement in dendritic spine morphogenesis and synapse formation emphasizes its importance in neuronal processes. PAK3, Human (Active, sf9, GST) is the recombinant human-derived PAK3 protein, expressed by sf9 insect cells, with N-Avi labeled tag.
Background
PAK3, a serine/threonine protein kinase, assumes a pivotal role in diverse signaling pathways, influencing cytoskeleton dynamics, cell migration, and cell cycle regulation. Its involvement in dendritic spine morphogenesis, synapse formation, and plasticity underscores its significance in neuronal processes. As a downstream effector of small GTPases CDC42 and RAC1, PAK3 undergoes activation through their binding, triggering autophosphorylation on multiple serine and/or threonine residues. The kinase activity of PAK3 extends to phosphorylating MAPK4 and MAPK6, activating the downstream target MAPKAPK5, which modulates F-actin polymerization and cell migration. Furthermore, PAK3 phosphorylates TNNI3/troponin I, impacting calcium sensitivity and relaxation kinetics of thin myofilaments. Its indispensable role in early neuronal development is evident, particularly in hippocampal neurons, where it facilitates dendritic spine formation and excitatory synapse establishment, possibly by regulating actomyosin contractility through myosin II regulatory light chain phosphorylation. The multifaceted functions of PAK3 highlight its intricate contributions to cellular processes critical for neuronal structure and function.
Technical Parameters
-
Species Human
-
Source sf9 insect cells
-
Tag N-GST
-
Accession
O75914-1 (M1-R559)
-
Gene ID5063
-
Molecular Construction
-
N-term
-
GST
-
(M1-R559)
Accession # O75914-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
PAK3; HPAK3; Prev. MRX30; PAK-3; Prev. MRX47; Adriamycin Resistance-Associated; BPAK; Mental Retardation, X-Linked 47; P21 Protein (Cdc42/Rac)-Activated Kinase 3; P21-Activated Kinase 3; Serine/Threonine-Protein Kinase PAK 3; PAK3beta; P21 (CDKN1A)-Activa
-
AA Sequence
MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTPDLYGSQMCPGKLPEGIPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSKETVNNQKYMSFTSGDKSAHGYIAAHPSSTKTASEPPLAPPVSEEEDEEEEEEEDENEPPPVIAPRPEHTKSIYTRSVVESIASPAVPNKEVTPPSAENANSSTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPLSSLTPLIIAAKEAIKNSSR
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipped with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)