panD Protein, Corynebacterium jeikeium
The panD protein plays a crucial role in cellular metabolism by catalyzing the pyruvyl-dependent decarboxylation of aspartate, thereby producing β-alanine. This enzyme activity represents a key step in the biosynthesis of pantothenic acid (vitamin B5), since beta-alanine is the precursor for the formation of this important cofactor. panD Protein, Corynebacterium jeikeium is the recombinant panD protein, expressed by E. coli , with tag free.
- Species: Others
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The panD protein plays a crucial role in cellular metabolism by catalyzing the pyruvyl-dependent decarboxylation of aspartate, thereby producing β-alanine. This enzyme activity represents a key step in the biosynthesis of pantothenic acid (vitamin B5), since beta-alanine is the precursor for the formation of this important cofactor. panD Protein, Corynebacterium jeikeium is the recombinant panD protein, expressed by E. coli , with tag free.
Background
The panD protein plays a crucial role in bacterial metabolism as it catalyzes the pyruvoyl-dependent decarboxylation of aspartate, resulting in the production of beta-alanine. This enzymatic activity is a key step in the biosynthesis of pantothenate, an essential precursor for coenzyme A (CoA) biosynthesis. CoA is involved in various fundamental cellular processes, serving as a cofactor for enzymes participating in fatty acid metabolism, the tricarboxylic acid (TCA) cycle, and other pathways. The pyruvoyl-dependent decarboxylation reaction catalyzed by panD represents a critical point in the regulation of pantothenate biosynthesis and, consequently, the cellular capacity for CoA production.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag Tag Free
-
Accession
Q4JXL3 (M1-A138)
-
Gene ID3432856
-
Molecular Construction
-
N-term
-
panD (M1-A138)
Accession # Q4JXL3 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
panD; Aspartate 1-decarboxylase; Aspartate alpha-decarboxylase; EC:4.1.1.11; jk0292
-
AA Sequence
MLRTMLKSKIHRATVTQADLHYVGSCTIDADLMEAADILEGEQIDIVDIDNGNRLTTYAITGDRGTGVIGINGAAARLISPGDLVIIIGYAQYSEEDLKNYASRVVFVDGNNKQVELGGDPAQVPDGSGLKNPRHPEA
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
