1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Lyases (EC 4)
  4. panD Protein, Corynebacterium jeikeium

The panD protein plays a crucial role in cellular metabolism by catalyzing the pyruvyl-dependent decarboxylation of aspartate, thereby producing β-alanine. This enzyme activity represents a key step in the biosynthesis of pantothenic acid (vitamin B5), since beta-alanine is the precursor for the formation of this important cofactor. panD Protein, Corynebacterium jeikeium is the recombinant panD protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The panD protein plays a crucial role in cellular metabolism by catalyzing the pyruvyl-dependent decarboxylation of aspartate, thereby producing β-alanine. This enzyme activity represents a key step in the biosynthesis of pantothenic acid (vitamin B5), since beta-alanine is the precursor for the formation of this important cofactor. panD Protein, Corynebacterium jeikeium is the recombinant panD protein, expressed by E. coli , with tag free.

Background

The panD protein plays a crucial role in bacterial metabolism as it catalyzes the pyruvoyl-dependent decarboxylation of aspartate, resulting in the production of beta-alanine. This enzymatic activity is a key step in the biosynthesis of pantothenate, an essential precursor for coenzyme A (CoA) biosynthesis. CoA is involved in various fundamental cellular processes, serving as a cofactor for enzymes participating in fatty acid metabolism, the tricarboxylic acid (TCA) cycle, and other pathways. The pyruvoyl-dependent decarboxylation reaction catalyzed by panD represents a critical point in the regulation of pantothenate biosynthesis and, consequently, the cellular capacity for CoA production.

Species

Others

Source

E. coli

Tag

Tag Free

Accession

Q4JXL3 (M1-A138)

Gene ID

3432856

Molecular Construction
N-term
panD (M1-A138)
Accession # Q4JXL3
C-term
Protein Length

Full Length

Synonyms
panD; Aspartate 1-decarboxylase; Aspartate alpha-decarboxylase
AA Sequence

MLRTMLKSKIHRATVTQADLHYVGSCTIDADLMEAADILEGEQIDIVDIDNGNRLTTYAITGDRGTGVIGINGAAARLISPGDLVIIIGYAQYSEEDLKNYASRVVFVDGNNKQVELGGDPAQVPDGSGLKNPRHPEA

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

panD Protein, Corynebacterium jeikeium Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

panD Protein, Corynebacterium jeikeium

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
panD Protein, Corynebacterium jeikeium
Cat. No.:
HY-P701949
Quantity:
MCE Japan Authorized Agent: