PCAF Protein, Human (His)

PCAF Protein, Human (His) is the recombinant human-derived PCAF, expressed by E. coli , with N-6*His labeled tag. ,

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Biological Activity
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PCAF Protein, Human (His) is the recombinant human-derived PCAF, expressed by E. coli , with N-6*His labeled tag. ,

Background

KAT2B functions as a histone acetyltransferase (HAT) that promotes transcriptional activation. It exhibits significant histone acetyltransferase activity with core histones (H3 and H4) and nucleosome core particles, with a strong preference for acetylation of H3 at 'Lys-9' (H3K9ac). KAT2B also acetylates non-histone proteins, including ACLY, MAPRE1/EB1, PLK4, RRP9/U3-55K, and TBX5. It inhibits cell-cycle progression and counteracts the mitogenic activity of the adenoviral oncoprotein E1A. Additionally, KAT2B acts as a circadian transcriptional coactivator, enhancing the activity of NPAS2-BMAL1 and CLOCK-BMAL1 heterodimers. In heart and limb development, it mediates TBX5 acetylation, regulating its nucleocytoplasmic shuttling. KAT2B negatively regulates centrosome amplification by acetylating PLK4 and impairs pre-rRNA processing by acetylating RRP9/U3-55K, a core subunit of the U3 snoRNP complex. It also promotes dynamic kinetochore-microtubule interactions in early mitosis by acetylating MAPRE1/EB1 and acetylates spermidine. During HIV-1 infection, KAT2B is recruited by the viral protein Tat, regulating Tat's transactivating activity and potentially aiding in chromatin remodeling of proviral genes.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • PCAF (K720-K832)
      Accession # Q92831
    • C-term
  • Protein Length

    Partial

  • Synonyms

    KAT2B; K(Lysine) Acetyltransferase 2B; Prev. PCAF; Histone Acetylase PCAF; P/CAF; GCN5L; P300/CBP-Associated Factor; GCN5; Spermidine Acetyltransferase KAT2B; CREBBP-Associated Factor; Histone Acetyltransferase KAT2B; CAF; Lysine Acetyltransferase 2B; His

  • AA Sequence

    KEPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK

  • Predicted Molecular Mass

    14.5 kDa

  • Molecular Weight

    Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00