PCAF Protein, Human (His)
PCAF Protein, Human (His) is the recombinant human-derived PCAF, expressed by E. coli , with N-6*His labeled tag. ,
- Species: Human
- Source: E. coli
Biological Activity
PCAF Protein, Human (His) is the recombinant human-derived PCAF, expressed by E. coli , with N-6*His labeled tag. ,
KAT2B functions as a histone acetyltransferase (HAT) that promotes transcriptional activation. It exhibits significant histone acetyltransferase activity with core histones (H3 and H4) and nucleosome core particles, with a strong preference for acetylation of H3 at 'Lys-9' (H3K9ac). KAT2B also acetylates non-histone proteins, including ACLY, MAPRE1/EB1, PLK4, RRP9/U3-55K, and TBX5. It inhibits cell-cycle progression and counteracts the mitogenic activity of the adenoviral oncoprotein E1A. Additionally, KAT2B acts as a circadian transcriptional coactivator, enhancing the activity of NPAS2-BMAL1 and CLOCK-BMAL1 heterodimers. In heart and limb development, it mediates TBX5 acetylation, regulating its nucleocytoplasmic shuttling. KAT2B negatively regulates centrosome amplification by acetylating PLK4 and impairs pre-rRNA processing by acetylating RRP9/U3-55K, a core subunit of the U3 snoRNP complex. It also promotes dynamic kinetochore-microtubule interactions in early mitosis by acetylating MAPRE1/EB1 and acetylates spermidine. During HIV-1 infection, KAT2B is recruited by the viral protein Tat, regulating Tat's transactivating activity and potentially aiding in chromatin remodeling of proviral genes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q92831 (K720-K832)
-
Gene ID8850
-
Molecular Construction
-
N-term
-
6*His
-
PCAF (K720-K832)
Accession # Q92831 -
C-term
-
-
Protein Length
Partial
-
Synonyms
KAT2B; K(Lysine) Acetyltransferase 2B; Prev. PCAF; Histone Acetylase PCAF; P/CAF; GCN5L; P300/CBP-Associated Factor; GCN5; Spermidine Acetyltransferase KAT2B; CREBBP-Associated Factor; Histone Acetyltransferase KAT2B; CAF; Lysine Acetyltransferase 2B; His
-
AA Sequence
KEPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK
-
Predicted Molecular Mass
14.5 kDa
-
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)