PCSK6 Protein, Human (His)

The PCSK6 protein is a serine endoprotease that plays a key role in preprotein processing by cleavage at sites with paired basic amino acids, specifically recognizing the RXXX[KR]R consensus motif. Its function may be involved in the constitutive secretory pathway, with a unique and limited distribution in neuroendocrine and non-neuroendocrine tissues. PCSK6 Protein, Human (His) is the recombinant human-derived PCSK6 protein, expressed by E. coli , with C-6*His labeled tag.

PCSK6 protein, a serine endoprotease, plays a pivotal role in the processing of diverse proproteins by cleaving at sites characterized by paired basic amino acids, specifically recognizing the RXXX[KR]R consensus motif. Its functional involvement is likely associated with the constitutive secretory pathway, exhibiting a distinctive and limited distribution within both neuroendocrine and non-neuroendocrine tissues. The enzyme's ability to precisely cleave substrates at specific motifs highlights its significance in the regulated processing of proproteins in various cellular contexts.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

C-6*His

P29122-1 (R860-G969)

5046  [NCBI]

Partial

REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG

Approximately 22 kDa, based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.