PCSK6 Protein, Human (His)
Based on 1 Customer Validation
The PCSK6 protein is a serine endoprotease that plays a key role in preprotein processing by cleavage at sites with paired basic amino acids, specifically recognizing the RXXX[KR]R consensus motif. Its function may be involved in the constitutive secretory pathway, with a unique and limited distribution in neuroendocrine and non-neuroendocrine tissues. PCSK6 Protein, Human (His) is the recombinant human-derived PCSK6 protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The PCSK6 protein is a serine endoprotease that plays a key role in preprotein processing by cleavage at sites with paired basic amino acids, specifically recognizing the RXXX[KR]R consensus motif. Its function may be involved in the constitutive secretory pathway, with a unique and limited distribution in neuroendocrine and non-neuroendocrine tissues. PCSK6 Protein, Human (His) is the recombinant human-derived PCSK6 protein, expressed by E. coli , with C-6*His labeled tag.
Background
PCSK6 protein, a serine endoprotease, plays a pivotal role in the processing of diverse proproteins by cleaving at sites characterized by paired basic amino acids, specifically recognizing the RXXX[KR]R consensus motif. Its functional involvement is likely associated with the constitutive secretory pathway, exhibiting a distinctive and limited distribution within both neuroendocrine and non-neuroendocrine tissues. The enzyme's ability to precisely cleave substrates at specific motifs highlights its significance in the regulated processing of proproteins in various cellular contexts.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P29122-1 (R860-G969)
-
Molecular Construction
-
N-term
-
PCSK6 (R860-G969)
Accession # P29122-1 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
PCSK6; SPC4; Prev. PACE4; Paired Basic Amino Acid Cleaving System 4; Subtilisin-Like Proprotein Convertase 4; Alternative Protein PCSK6; Subtilisin/Kexin-Like Protease PACE4; Subtilisin-Like Protease; Proprotein Convertase Subtilisin/Kexin Type 6; Paired
-
AA Sequence
REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG
-
Predicted Molecular Mass
19.4 kDa
-
Molecular Weight
Approximately 22 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)