PD-L2 Protein, Mouse (Biotinylated, HEK293, His-Avi)
PD-L2 Protein plays a critical role in the T-cell costimulatory signal, fostering proliferation and IFNG production independently of PDCD1. While interacting with PDCD1 inhibits T-cell proliferation, PD-L2 itself intricately promotes immune responses. The dynamic interplay emphasizes PD-L2's dual role in either promoting or inhibiting T-cell activation within the immune signaling network, showcasing intricate regulatory mechanisms. PD-L2, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived PD-L2 protein, expressed by HEK293, with N-Avi labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PD-L2 Protein plays a critical role in the T-cell costimulatory signal, fostering proliferation and IFNG production independently of PDCD1. While interacting with PDCD1 inhibits T-cell proliferation, PD-L2 itself intricately promotes immune responses. The dynamic interplay emphasizes PD-L2's dual role in either promoting or inhibiting T-cell activation within the immune signaling network, showcasing intricate regulatory mechanisms. PD-L2, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived PD-L2 protein, expressed by HEK293, with N-Avi labeled tag.
Background
The PD-L2 Protein assumes a critical role in the costimulatory signal necessary for T-cell proliferation and IFNG production, operating in a PDCD1-independent manner. While its interaction with PDCD1 can inhibit T-cell proliferation by impeding cell cycle progression and cytokine production, PD-L2 itself is intricately involved in fostering these immune responses. The dynamic interplay between PD-L2 and PDCD1 highlights the regulatory mechanisms at play, emphasizing the protein's dual role in promoting or inhibiting T-cell activation based on its interactions within the immune signaling network.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-Avi;C-His
-
Accession
Q9WUL5 (L20-R219)
-
Gene ID58205
-
Molecular Construction
-
N-term
-
PD-L2 (L20-R219)
Accession # Q9WUL5 -
His-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
PDCD1LG2; B7 Dendritic Cell Molecule; Programmed Cell Death 1 Ligand 2; Programmed Death Ligand 2; PD-L2; Butyrophilin B7-DC; CD273; PDCD1 Ligand 2; B7-DC; PDCD1L2; PDL2; PD-1-Ligand 2; B7DC; CD273 Antigen; BA574F11.2; PD-1 Ligand 2; Btdc
-
AA Sequence
LFTVTAPKEVYTVDVGSSVSLECDFDRRECTELEGIRASLQKVENDTSLQSERATLLEEQLPLGKALFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASYMRIDTRILEVPGTGEVQLTCQARGYPLAEVSWQNVSVPANTSHIRTPEGLYQVTSVLRLKPQPSRNFSCMFWNAHMKELTSAIIDPLSRMEPKVPR
-
Predicted Molecular Mass
26.1 kDa
-
Molecular Weight
Approximately 35-43 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
