PDPK1 Protein, Human (sf9, His)

Customer Review

Based on 1 Customer Validation

PDPK1 protein is the core kinase of the AGC family and can phosphorylate and activate various downstream kinases, including PKB/AKT1, RPS6KB1, PRKACA, PRKCD, SGK1, PAK1 and PKN. It transduces insulin signals and regulates cellular processes such as proliferation, survival, and nutrient absorption. PDPK1 Protein, Human (sf9, His) is the recombinant human-derived PDPK1 protein, expressed by sf9 insect cells , with N-8*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PDPK1 protein is the core kinase of the AGC family and can phosphorylate and activate various downstream kinases, including PKB/AKT1, RPS6KB1, PRKACA, PRKCD, SGK1, PAK1 and PKN. It transduces insulin signals and regulates cellular processes such as proliferation, survival, and nutrient absorption. PDPK1 Protein, Human (sf9, His) is the recombinant human-derived PDPK1 protein, expressed by sf9 insect cells , with N-8*His labeled tag.

Background

PDPK1, a serine/threonine kinase, assumes a central role as a master kinase within the AGC family, orchestrating the phosphorylation and activation of various downstream protein kinases. Its diverse targets include protein kinase B (PKB/AKT1, PKB/AKT2, PKB/AKT3), p70 ribosomal protein S6 kinase (RPS6KB1), p90 ribosomal protein S6 kinase (RPS6KA1, RPS6KA2, and RPS6KA3), cyclic AMP-dependent protein kinase (PRKACA), protein kinase C (PRKCD and PRKCZ), serum and glucocorticoid-inducible kinase (SGK1, SGK2, and SGK3), p21-activated kinase-1 (PAK1), and protein kinase PKN (PKN1 and PKN2). PDPK1 plays a pivotal role in transducing insulin signals by activating PKB/AKT1, thereby regulating downstream targets involved in cell proliferation, survival, glucose and amino acid uptake, and storage. Additionally, it exerts regulatory functions, negatively modulating TGF-beta-induced signaling and activating PPARG transcriptional activity to promote adipocyte differentiation. PDPK1 further participates in diverse cellular processes, including the activation of the NF-kappa-B pathway via IKKB phosphorylation, regulation of focal adhesions by angiotensin II, control of pancreatic cell proliferation, and modulation of Ca(2+) entry and Ca(2+)-activated K(+) channels in mast cells. It also plays critical roles in endothelial cell motility, cardiac homeostasis, thymocyte development, and provides negative feedback inhibition in toll-like receptor-mediated NF-kappa-B activation in macrophages, with isoform 3 being catalytically inactive.

Verified Bioactivity

The kinase activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 8*His
    • PDPK1 (M51-A360)
      Accession # O15530
    • C-term
  • Protein Length

    Partial

  • Synonyms

    PDPK1; PkB Kinase Like Gene 1; 3-Phosphoinositide Dependent Protein Kinase 1; PkB Kinase; PDK1; PRO0461; 3-Phosphoinositide-Dependent Protein Kinase 1; HPDK1; Non-Specific Serine/Threonine Protein Kinase

  • AA Sequence

    MDGTAAEPRPGAGSLQHAQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTA

  • Predicted Molecular Mass

    37.6 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.0, 200 mM NaCl, 20% glycerol, 1 mM DTT.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00