1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins AGC
  4. PDK1
  5. PDPK1/PDK1
  6. PDPK1 Protein, Human (sf9, His)

PDPK1 protein is the core kinase of the AGC family and can phosphorylate and activate various downstream kinases, including PKB/AKT1, RPS6KB1, PRKACA, PRKCD, SGK1, PAK1 and PKN. It transduces insulin signals and regulates cellular processes such as proliferation, survival, and nutrient absorption. PDPK1 Protein, Human (sf9, His) is the recombinant human-derived PDPK1 protein, expressed by sf9 insect cells , with N-8*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PDPK1 protein is the core kinase of the AGC family and can phosphorylate and activate various downstream kinases, including PKB/AKT1, RPS6KB1, PRKACA, PRKCD, SGK1, PAK1 and PKN. It transduces insulin signals and regulates cellular processes such as proliferation, survival, and nutrient absorption. PDPK1 Protein, Human (sf9, His) is the recombinant human-derived PDPK1 protein, expressed by sf9 insect cells , with N-8*His labeled tag.

Background

PDPK1, a serine/threonine kinase, assumes a central role as a master kinase within the AGC family, orchestrating the phosphorylation and activation of various downstream protein kinases. Its diverse targets include protein kinase B (PKB/AKT1, PKB/AKT2, PKB/AKT3), p70 ribosomal protein S6 kinase (RPS6KB1), p90 ribosomal protein S6 kinase (RPS6KA1, RPS6KA2, and RPS6KA3), cyclic AMP-dependent protein kinase (PRKACA), protein kinase C (PRKCD and PRKCZ), serum and glucocorticoid-inducible kinase (SGK1, SGK2, and SGK3), p21-activated kinase-1 (PAK1), and protein kinase PKN (PKN1 and PKN2). PDPK1 plays a pivotal role in transducing insulin signals by activating PKB/AKT1, thereby regulating downstream targets involved in cell proliferation, survival, glucose and amino acid uptake, and storage. Additionally, it exerts regulatory functions, negatively modulating TGF-beta-induced signaling and activating PPARG transcriptional activity to promote adipocyte differentiation. PDPK1 further participates in diverse cellular processes, including the activation of the NF-kappa-B pathway via IKKB phosphorylation, regulation of focal adhesions by angiotensin II, control of pancreatic cell proliferation, and modulation of Ca(2+) entry and Ca(2+)-activated K(+) channels in mast cells. It also plays critical roles in endothelial cell motility, cardiac homeostasis, thymocyte development, and provides negative feedback inhibition in toll-like receptor-mediated NF-kappa-B activation in macrophages, with isoform 3 being catalytically inactive.

Biological Activity

The kinase activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

Sf9 insect cells

Tag

N-8*His

Accession

O15530 (M51-A360)

Gene ID

5170

Molecular Construction
N-term
8*His
PDPK1 (M51-A360)
Accession # O15530
C-term
Protein Length

Partial

Synonyms
PDPK1; 3-phosphoinositide-dependent protein kinase 1; hPDK1
AA Sequence

MDGTAAEPRPGAGSLQHAQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTA

Molecular Weight

37.6 KDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.0, 200 mM NaCl, 20% glycerol, 1 mM DTT.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PDPK1 Protein, Human (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PDPK1 Protein, Human (sf9, His)
Cat. No.:
HY-P701739
Quantity:
MCE Japan Authorized Agent: