PDPK1 Protein, Human (sf9, His)
Based on 1 Customer Validation
PDPK1 protein is the core kinase of the AGC family and can phosphorylate and activate various downstream kinases, including PKB/AKT1, RPS6KB1, PRKACA, PRKCD, SGK1, PAK1 and PKN. It transduces insulin signals and regulates cellular processes such as proliferation, survival, and nutrient absorption. PDPK1 Protein, Human (sf9, His) is the recombinant human-derived PDPK1 protein, expressed by sf9 insect cells , with N-8*His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
PDPK1 protein is the core kinase of the AGC family and can phosphorylate and activate various downstream kinases, including PKB/AKT1, RPS6KB1, PRKACA, PRKCD, SGK1, PAK1 and PKN. It transduces insulin signals and regulates cellular processes such as proliferation, survival, and nutrient absorption. PDPK1 Protein, Human (sf9, His) is the recombinant human-derived PDPK1 protein, expressed by sf9 insect cells , with N-8*His labeled tag.
Background
PDPK1, a serine/threonine kinase, assumes a central role as a master kinase within the AGC family, orchestrating the phosphorylation and activation of various downstream protein kinases. Its diverse targets include protein kinase B (PKB/AKT1, PKB/AKT2, PKB/AKT3), p70 ribosomal protein S6 kinase (RPS6KB1), p90 ribosomal protein S6 kinase (RPS6KA1, RPS6KA2, and RPS6KA3), cyclic AMP-dependent protein kinase (PRKACA), protein kinase C (PRKCD and PRKCZ), serum and glucocorticoid-inducible kinase (SGK1, SGK2, and SGK3), p21-activated kinase-1 (PAK1), and protein kinase PKN (PKN1 and PKN2). PDPK1 plays a pivotal role in transducing insulin signals by activating PKB/AKT1, thereby regulating downstream targets involved in cell proliferation, survival, glucose and amino acid uptake, and storage. Additionally, it exerts regulatory functions, negatively modulating TGF-beta-induced signaling and activating PPARG transcriptional activity to promote adipocyte differentiation. PDPK1 further participates in diverse cellular processes, including the activation of the NF-kappa-B pathway via IKKB phosphorylation, regulation of focal adhesions by angiotensin II, control of pancreatic cell proliferation, and modulation of Ca(2+) entry and Ca(2+)-activated K(+) channels in mast cells. It also plays critical roles in endothelial cell motility, cardiac homeostasis, thymocyte development, and provides negative feedback inhibition in toll-like receptor-mediated NF-kappa-B activation in macrophages, with isoform 3 being catalytically inactive.
Verified Bioactivity
The kinase activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-8*His
-
Accession
O15530 (M51-A360)
-
Gene ID5170
-
Molecular Construction
-
N-term
-
8*His
-
PDPK1 (M51-A360)
Accession # O15530 -
C-term
-
-
Protein Length
Partial
-
Synonyms
PDPK1; PkB Kinase Like Gene 1; 3-Phosphoinositide Dependent Protein Kinase 1; PkB Kinase; PDK1; PRO0461; 3-Phosphoinositide-Dependent Protein Kinase 1; HPDK1; Non-Specific Serine/Threonine Protein Kinase
-
AA Sequence
MDGTAAEPRPGAGSLQHAQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTA
-
Predicted Molecular Mass
37.6 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.0, 200 mM NaCl, 20% glycerol, 1 mM DTT.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)