PE2R4 Protein, Human (sf9)
PE2R4 Protein, Human (sf9) is the recombinant human-derived PE2R4, expressed by sf9 insect cells , with tag Free labeled tag. ,
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
PE2R4 Protein, Human (sf9) is the recombinant human-derived PE2R4, expressed by sf9 insect cells , with tag Free labeled tag. ,
PE2R4 is a receptor for prostaglandin E2 (PGE2), with its activity mediated by G(s) proteins that stimulate adenylate cyclase. It exerts a relaxing effect on smooth muscle and may play a significant role in regulating renal hemodynamics, intestinal epithelial transport, adrenal aldosterone secretion, and uterine function.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag Tag Free
-
Accession
P35408 (P4-F217, F260-C346, N7Q, N177Q)
-
Gene ID5734
-
Protein Length
Partial
-
Synonyms
PTGER4; PGE2 Receptor EP4 Subtype; Prostaglandin E Receptor 4; PGE Receptor, EP4 Subtype; Prostaglandin E2 Receptor EP4 Subtype; PGE Receptor EP4 Subtype; Prostanoid EP4 Receptor; PTGER2; EP4; EP4R; Prostaglandin E Receptor 4 (Subtype EP4)
-
AA Sequence
FRRIAGAEIQMVILLIATSLVVLICSIPLVVRVFVNQLYQPSLEREVSKNPDLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIKC
-
Predicted Molecular Mass
34.2 kDa
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
