PRDX1/Peroxiredoxin-1 Protein, Human (P. pastoris, His)
Based on 1 Customer Validation
Peroxiredoxin-1 (PRDX1) is a thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides and plays a crucial role in cellular protection against oxidative stress. It detoxifies peroxide and senses hydrogen peroxide-mediated signaling events. PRDX1/Peroxiredoxin-1 Protein, Human (P. pastoris, His) is the recombinant human-derived Peroxiredoxin-1 protein, expressed by P. pastoris , with C-6*His labeled tag.
- Species: Human
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Peroxiredoxin-1 (PRDX1) is a thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides and plays a crucial role in cellular protection against oxidative stress. It detoxifies peroxide and senses hydrogen peroxide-mediated signaling events. PRDX1/Peroxiredoxin-1 Protein, Human (P. pastoris, His) is the recombinant human-derived Peroxiredoxin-1 protein, expressed by P. pastoris , with C-6*His labeled tag.
Background
Peroxiredoxin-1 (PRDX1), a thiol-specific peroxidase, serves as a catalytic agent in the reduction of hydrogen peroxide and organic hydroperoxides, converting them into water and alcohols, respectively. Its crucial role in cellular protection against oxidative stress involves detoxifying peroxides and acting as a sensor for hydrogen peroxide-mediated signaling events. PRDX1 may also contribute to the signaling cascades initiated by growth factors and tumor necrosis factor-alpha, potentially influencing intracellular H(2)O(2) concentrations. Notably, PRDX1 exhibits the ability to reduce an intramolecular disulfide bond in GDPD5, modulating GDPD5's capacity to drive postmitotic motor neuron differentiation. These multifaceted functions underscore PRDX1's intricate involvement in redox signaling and cellular differentiation processes.
Technical Parameters
-
Species Human
-
Source P. pastoris
-
Tag C-6*His
-
Accession
Q06830 (M1-K199)
-
Gene ID5052
-
Molecular Construction
-
N-term
-
Peroxiredoxin-1 (M1-K199)
Accession # Q06830 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
PRDX1; TDPX2; Prev. PAGA; PAG; Thioredoxin-Dependent Peroxide Reductase 2; Epididymis Secretory Sperm Binding Protein; Thioredoxin-Dependent Peroxiredoxin 1; Thioredoxin-Dependent Peroxiredoxin; Thioredoxin Peroxidase 2; Natural Killer-Enhancing Factor A;
-
AA Sequence
MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK
-
Molecular Weight
Approximately 22 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
