PET hydrolase Protein, Thermobifida alba (His, Strep)
PET hydrolase Protein, Thermobifida alba (His, Strep) is the recombinant PET hydrolase, expressed by E. coli , with Strep, His labeled tag. ,
- Species: Others
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PET hydrolase Protein, Thermobifida alba (His, Strep) is the recombinant PET hydrolase, expressed by E. coli , with Strep, His labeled tag. ,
Background
PET hydrolase is an enzyme that catalyzes the hydrolysis of cutin, a polyester forming the structural component of the plant cuticle (PubMed:25910960). It exhibits esterase activity toward p-nitrophenol-linked aliphatic esters (pNP-aliphatic esters) (PubMed:25910960). Notably, PET hydrolase is capable of degrading poly(ethylene terephthalate) (PET), the most abundant polyester plastic worldwide (PubMed:25910960). Additionally, it can depolymerize the synthetic polyester poly(epsilon-caprolactone) (PCL) (PubMed:25910960). by similar: No related content to note.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag Strep;His
-
Accession
D4Q9N1 (A36-F296)
-
Gene ID/
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Cutinase est1; EC:3.1.1.74; Poly(ethylene terephthalate) hydrolase; PET hydrolase; PETase; EC:3.1.1.101; est1
-
AA Sequence
ANPYERGPNPTESMLEARSGPFSVSEERASRLGADGFGGGTIYYPRENNTYGAIAISPGYTGTQSSIAWLGERIASHGFVVIAIDTNTTLDQPDSRARQLNAALDYMLTDASSSVRNRIDASRLAVMGHSMGGGGTLRLASQRPDLKAAIPLTPWHLNKSWRDITVPTLIIGADLDTIAPVSSHSEPFYNSIPSSTDKAYLELNNATHFAPNITNKTIGMYSVAWLKRFVDEDTRYTQFLCPGPRTGLLSDVDEYRSTCPF
-
Predicted Molecular Mass
31 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
