1. Recombinant Proteins
  2. Others
  3. PGD Protein, Human (His)

PGD Protein is crucial in cellular metabolism, catalyzing the oxidative decarboxylation of 6-phosphogluconate. This process yields ribulose 5-phosphate, releases CO(2), and simultaneously reduces NADP to NADPH, contributing to essential cellular redox balance. The enzyme's functionality underscores its significance in maintaining cellular homeostasis and participating in key metabolic pathways. PGD Protein, Human (His) is the recombinant human-derived PGD protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PGD Protein is crucial in cellular metabolism, catalyzing the oxidative decarboxylation of 6-phosphogluconate. This process yields ribulose 5-phosphate, releases CO(2), and simultaneously reduces NADP to NADPH, contributing to essential cellular redox balance. The enzyme's functionality underscores its significance in maintaining cellular homeostasis and participating in key metabolic pathways. PGD Protein, Human (His) is the recombinant human-derived PGD protein, expressed by E. coli , with N-His labeled tag.

Background

PGD Protein plays a pivotal role in cellular metabolism by catalyzing the oxidative decarboxylation of 6-phosphogluconate, leading to the formation of ribulose 5-phosphate and the release of CO(2). This enzymatic process is coupled with the simultaneous reduction of NADP to NADPH, contributing to vital cellular redox balance. The functionality of PGD Protein in mediating these biochemical reactions underscores its significance in maintaining cellular homeostasis and participating in key metabolic pathways.

Species

Human

Source

E. coli

Tag

N-His

Accession

P52209-1 (M1-A483)

Gene ID

5226  [NCBI]

Molecular Construction
N-term
His
PGD (M1-A483)
Accession # P52209-1
C-term
Protein Length

Full Length of Isoform-1

Synonyms
6-phosphogluconate dehydrogenase, decarboxylating; PGD; PGDH
AA Sequence

MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSSYNA

Predicted Molecular Mass
54.6 kDa
Molecular Weight

Approximately 46 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 85%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PGD Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PGD Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PGD Protein, Human (His)
Cat. No.:
HY-P73376
Quantity:
MCE Japan Authorized Agent: