PGD Protein, Human (His)
PGD Protein is crucial in cellular metabolism, catalyzing the oxidative decarboxylation of 6-phosphogluconate. This process yields ribulose 5-phosphate, releases CO(2), and simultaneously reduces NADP to NADPH, contributing to essential cellular redox balance. The enzyme's functionality underscores its significance in maintaining cellular homeostasis and participating in key metabolic pathways. PGD Protein, Human (His) is the recombinant human-derived PGD protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
PGD Protein is crucial in cellular metabolism, catalyzing the oxidative decarboxylation of 6-phosphogluconate. This process yields ribulose 5-phosphate, releases CO(2), and simultaneously reduces NADP to NADPH, contributing to essential cellular redox balance. The enzyme's functionality underscores its significance in maintaining cellular homeostasis and participating in key metabolic pathways. PGD Protein, Human (His) is the recombinant human-derived PGD protein, expressed by E. coli , with N-His labeled tag.
PGD Protein plays a pivotal role in cellular metabolism by catalyzing the oxidative decarboxylation of 6-phosphogluconate, leading to the formation of ribulose 5-phosphate and the release of CO(2). This enzymatic process is coupled with the simultaneous reduction of NADP to NADPH, contributing to vital cellular redox balance. The functionality of PGD Protein in mediating these biochemical reactions underscores its significance in maintaining cellular homeostasis and participating in key metabolic pathways.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
P52209-1 (M1-A483)
-
Gene ID5226 [NCBI]
-
Molecular Construction
-
N-term
-
His
-
PGD (M1-A483)
Accession # P52209-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
6-phosphogluconate dehydrogenase, decarboxylating; PGD; PGDH
-
AA Sequence
MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSSYNA
-
Predicted Molecular Mass
54.6 kDa
-
Molecular Weight
Approximately 46 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
