1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Isomerases (EC 5)
  4. PGD2 Synthase/PTGDS Protein, Rat (HEK293, His)

The PGD2 synthase/PTGDS protein converts PGH2 to PGD2, which regulates smooth muscle and inhibits platelet aggregation.It affects central nervous system functions including sedation, NREM sleep, and potential anti-apoptotic effects on oligodendrocytes.PGD2 Synthase/PTGDS Protein, Rat (HEK293, His) is the recombinant rat-derived PGD2 Synthase/PTGDS protein, expressed by HEK293 , with C-His, C-6*His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
무료 샘플   Apply now
5 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

The PGD2 synthase/PTGDS protein converts PGH2 to PGD2, which regulates smooth muscle and inhibits platelet aggregation.It affects central nervous system functions including sedation, NREM sleep, and potential anti-apoptotic effects on oligodendrocytes.PGD2 Synthase/PTGDS Protein, Rat (HEK293, His) is the recombinant rat-derived PGD2 Synthase/PTGDS protein, expressed by HEK293 , with C-His, C-6*His labeled tag.

Background

The PGD2 Synthase, also known as PTGDS protein, is a key enzymatic player in diverse physiological processes. It catalyzes the conversion of PGH2 to PGD2, a prostaglandin essential for smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation. Beyond its vascular functions, PTGDS is intricately involved in various central nervous system (CNS) activities, including sedation, NREM sleep, and PGE2-induced allodynia, and may exert an anti-apoptotic role in oligodendrocytes. The protein exhibits a broad substrate-binding capacity, interacting with small non-substrate lipophilic molecules like biliverdin, bilirubin, retinal, retinoic acid, and thyroid hormone, potentially acting as a scavenger for harmful hydrophobic molecules and functioning as a secretory retinoid and thyroid hormone transporter. PTGDS is implicated in the development and maintenance of blood barriers, including the blood-brain, blood-retina, blood-aqueous humor, and blood-testis barriers, highlighting its significance in barrier function. Moreover, it plays pivotal roles in both the maturation and maintenance of the central nervous system and the male reproductive system. Additionally, PTGDS participates in PLA2G3-dependent mast cell maturation, where PLA2G3, secreted by immature mast cells, acts upstream to PTGDS to synthesize PGD2. This, in turn, promotes mast cell maturation and degranulation via PTGDR, indicating its involvement in immune responses and cellular maturation.

Biological Activity

Measured by its ability to catalyse the conversion of PGH2 to PGD2. The specific activity is 5.6394 pg/min/µg that incubate at 25°C for 1 minutes.

Species

Rat

Source

HEK293

Tag

C-6*His

Accession

P22057/NP_037147.1 (Q25-E189)

Gene ID
Molecular Construction
N-term
PTGDS (Q25-E189)
Accession # P22057/NP_037147.1
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Prostaglandin-H2 D-isomerase; L-PGDS; PGDS2; PTGDS
AA Sequence

QGHDTVQPNFQQDKFLGRWYSAGLASNSSWFREKKELLFMCQTVVAPSTEGGLNLTSTFLRKNQCETKVMVLQPAGVPGQYTYNSPHWGSFHSLSVVETDYDEYAFLFSKGTKGPGQDFRMATLYSRAQLLKEELKEKFITFSKDQGLTEEDIVFLPQPDKCIQE

분자량

Approximately 26-29 kDa

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

PGD2 Synthase/PTGDS Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

PGD2 Synthase/PTGDS Protein, Rat (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
PGD2 Synthase/PTGDS Protein, Rat (HEK293, His)
Cat. No.:
HY-P73709
수량:
MCE Japan Authorized Agent: