PGD2 Synthase/PTGDS Protein, Rat (HEK293, His)

Customer Review

Based on 1 Customer Validation

The PGD2 synthase/PTGDS protein converts PGH2 to PGD2, which regulates smooth muscle and inhibits platelet aggregation.It affects central nervous system functions including sedation, NREM sleep, and potential anti-apoptotic effects on oligodendrocytes.PGD2 Synthase/PTGDS Protein, Rat (HEK293, His) is the recombinant rat-derived PGD2 Synthase/PTGDS protein, expressed by HEK293 , with C-His, C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The PGD2 synthase/PTGDS protein converts PGH2 to PGD2, which regulates smooth muscle and inhibits platelet aggregation.It affects central nervous system functions including sedation, NREM sleep, and potential anti-apoptotic effects on oligodendrocytes.PGD2 Synthase/PTGDS Protein, Rat (HEK293, His) is the recombinant rat-derived PGD2 Synthase/PTGDS protein, expressed by HEK293 , with C-His, C-6*His labeled tag.

Background

The PGD2 Synthase, also known as PTGDS protein, is a key enzymatic player in diverse physiological processes. It catalyzes the conversion of PGH2 to PGD2, a prostaglandin essential for smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation. Beyond its vascular functions, PTGDS is intricately involved in various central nervous system (CNS) activities, including sedation, NREM sleep, and PGE2-induced allodynia, and may exert an anti-apoptotic role in oligodendrocytes. The protein exhibits a broad substrate-binding capacity, interacting with small non-substrate lipophilic molecules like biliverdin, bilirubin, retinal, retinoic acid, and thyroid hormone, potentially acting as a scavenger for harmful hydrophobic molecules and functioning as a secretory retinoid and thyroid hormone transporter. PTGDS is implicated in the development and maintenance of blood barriers, including the blood-brain, blood-retina, blood-aqueous humor, and blood-testis barriers, highlighting its significance in barrier function. Moreover, it plays pivotal roles in both the maturation and maintenance of the central nervous system and the male reproductive system. Additionally, PTGDS participates in PLA2G3-dependent mast cell maturation, where PLA2G3, secreted by immature mast cells, acts upstream to PTGDS to synthesize PGD2. This, in turn, promotes mast cell maturation and degranulation via PTGDR, indicating its involvement in immune responses and cellular maturation.

Verified Bioactivity

Measured by its ability to catalyse the conversion of PGH2 to PGD2. The specific activity is 5.6394 pg/min/µg that incubate at 25°C for 1 minutes.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • PTGDS (Q25-E189)
      Accession # P22057/NP_037147.1
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    PTGDS; PGD2 Synthase; Prostaglandin D2 Synthase; Cerebrin-28; L-PGDS; PGDS2; PGDS; PDS; Glutathione-Independent PGD Synthase; Testis Tissue Sperm-Binding Protein Li 63n; Prostaglandin-H2 D-Isomerase; Prostaglandin D2 Synthase (21kD, Brain); Lipocalin-Type

  • AA Sequence

    QGHDTVQPNFQQDKFLGRWYSAGLASNSSWFREKKELLFMCQTVVAPSTEGGLNLTSTFLRKNQCETKVMVLQPAGVPGQYTYNSPHWGSFHSLSVVETDYDEYAFLFSKGTKGPGQDFRMATLYSRAQLLKEELKEKFITFSKDQGLTEEDIVFLPQPDKCIQE

  • Molecular Weight

    Approximately 26-29 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00