Phytanoyl-CoA dioxygenase Protein, Actinophytocola oryzae
Phytyl-CoA dioxygenase (PHYH) is an enzyme involved in the alpha-oxidation of phytanic acid, a branched-chain fatty acid. PHYH catalyzes the conversion of phytyl-CoA to 2-hydroxyphytyl-CoA, initiating the degradation pathway. Phytanoyl-CoA dioxygenase Protein, Actinophytocola oryzae is the recombinant Phytanoyl-CoA dioxygenase protein, expressed by E. coli , with tag free.
- Species: Others
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Phytyl-CoA dioxygenase (PHYH) is an enzyme involved in the alpha-oxidation of phytanic acid, a branched-chain fatty acid. PHYH catalyzes the conversion of phytyl-CoA to 2-hydroxyphytyl-CoA, initiating the degradation pathway. Phytanoyl-CoA dioxygenase Protein, Actinophytocola oryzae is the recombinant Phytanoyl-CoA dioxygenase protein, expressed by E. coli , with tag free.
Background
Phytanoyl-CoA dioxygenase (PHYH) is an enzyme critical for the alpha-oxidation of phytanic acid, a branched-chain fatty acid. PHYH catalyzes the conversion of phytanoyl-CoA to 2-hydroxyphytanoyl-CoA, initiating the degradation pathway. This process is essential for preventing the accumulation of phytanic acid, which is associated with Refsum disease. PHYH's role underscores its significance in maintaining lipid homeostasis and preventing metabolic disorders.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag Tag Free
-
Accession
S5TUM1 (M1-F266)
-
Gene ID/
-
Molecular Construction
-
N-term
-
PhyH (M1-F266)
Accession # S5TUM1 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
Phytanoyl-CoA dioxygenase
-
AA Sequence
MEPHDTLSPAQVDEYRKNGFLVQEHVFDEEEIELLRAEAAQEFASGGERVTVEQNTGIVRGVHGCHLYSEVFGRLVRSPRLLPIARQLLRDDVYVHQFKINAKRAFKGEVWEWHQDYTFWHHEDGMPAPRALSAAIFLDEVTEFNGPLTFVPGGHGSGMIDADVKGEGWANTLTASLKYSLDVETMRGLIERNGMVAPKGPRGSVLWFDANIPHSSVPNISPFDRGLVLITYNSVENKTDVTRGTRPEWLAARDFTPLTALQATSF
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
