Phytanoyl-CoA dioxygenase Protein, Actinophytocola oryzae

Phytyl-CoA dioxygenase (PHYH) is an enzyme involved in the alpha-oxidation of phytanic acid, a branched-chain fatty acid. PHYH catalyzes the conversion of phytyl-CoA to 2-hydroxyphytyl-CoA, initiating the degradation pathway. Phytanoyl-CoA dioxygenase Protein, Actinophytocola oryzae is the recombinant Phytanoyl-CoA dioxygenase protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Others
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Phytyl-CoA dioxygenase (PHYH) is an enzyme involved in the alpha-oxidation of phytanic acid, a branched-chain fatty acid. PHYH catalyzes the conversion of phytyl-CoA to 2-hydroxyphytyl-CoA, initiating the degradation pathway. Phytanoyl-CoA dioxygenase Protein, Actinophytocola oryzae is the recombinant Phytanoyl-CoA dioxygenase protein, expressed by E. coli , with tag free.

Background

Phytanoyl-CoA dioxygenase (PHYH) is an enzyme critical for the alpha-oxidation of phytanic acid, a branched-chain fatty acid. PHYH catalyzes the conversion of phytanoyl-CoA to 2-hydroxyphytanoyl-CoA, initiating the degradation pathway. This process is essential for preventing the accumulation of phytanic acid, which is associated with Refsum disease. PHYH's role underscores its significance in maintaining lipid homeostasis and preventing metabolic disorders.

Technical Parameters

  • Species Others
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • PhyH (M1-F266)
      Accession # S5TUM1
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    Phytanoyl-CoA dioxygenase

  • AA Sequence

    MEPHDTLSPAQVDEYRKNGFLVQEHVFDEEEIELLRAEAAQEFASGGERVTVEQNTGIVRGVHGCHLYSEVFGRLVRSPRLLPIARQLLRDDVYVHQFKINAKRAFKGEVWEWHQDYTFWHHEDGMPAPRALSAAIFLDEVTEFNGPLTFVPGGHGSGMIDADVKGEGWANTLTASLKYSLDVETMRGLIERNGMVAPKGPRGSVLWFDANIPHSSVPNISPFDRGLVLITYNSVENKTDVTRGTRPEWLAARDFTPLTALQATSF

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00