Copy Link Print Information

PIM3 Protein, Human (Active, sf9, GST)

Customer Review

Based on 1 Customer Validation

The PIM3 protein is a serine/threonine kinase proto-oncogene that is crucial in preventing apoptosis, promoting cell survival, and protein translation in underlying tumorigenesis. It phosphorylates BAD, releases anti-apoptotic Bcl-X(L) and affects cell cycle, protein synthesis and MYC transcriptional activity, showing multifaceted effects on tumorigenesis. PIM3 Protein, Human (sf9, GST) is the recombinant human-derived PIM3 protein, expressed by sf9 insect cells , with N-GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • PIM3 Protein, Human (Active, sf9, GST) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The PIM3 protein is a serine/threonine kinase proto-oncogene that is crucial in preventing apoptosis, promoting cell survival, and protein translation in underlying tumorigenesis. It phosphorylates BAD, releases anti-apoptotic Bcl-X(L) and affects cell cycle, protein synthesis and MYC transcriptional activity, showing multifaceted effects on tumorigenesis. PIM3 Protein, Human (sf9, GST) is the recombinant human-derived PIM3 protein, expressed by sf9 insect cells , with N-GST labeled tag.

Background

The PIM3 protein, a proto-oncogene with serine/threonine kinase activity, plays a pivotal role in preventing apoptosis and promoting cell survival and protein translation, potentially contributing to tumorigenesis through various mechanisms. It delivers survival signals by phosphorylating BAD, leading to the release of the anti-apoptotic protein Bcl-X(L). PIM3 regulates cell cycle progression, protein synthesis, and MYC transcriptional activity, highlighting its multifaceted impact on tumorigenesis. Additionally, it negatively regulates insulin secretion by inhibiting the activation of MAPK1/3 (ERK1/2) through SOCS6. Beyond its role in tumorigenesis, PIM3 is involved in the control of energy metabolism and regulates AMPK activity, modulating MYC and PPARGC1A protein levels and influencing cell growth.

Verified Bioactivity

The activity was measured by off-chip mobility shift assay(MSA). The enzyme was incubated with fluorecence-labeled substrate and Mg(or Mn)/ATP. The phosphorylated and unphosphorylated substrates were separated and detected by MSA device. When the protein concentration is 0.25 nM, the conversion rate is about 20%.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-GST
  • Accession

    Q86V86 (L2-L326)

  • Gene ID
    415116
  • Molecular Construction
    • N-term
    • GST
    • PIM3 (L2-L326)
      Accession # Q86V86
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    PIM3; Non-Specific Serine/Threonine Protein Kinase; Pim-3 Proto-Oncogene, Serine/Threonine Kinase; Serine/Threonine Kinase Pim-3; Serine/Threonine-Protein Kinase Pim-3; Pim-3; Pim-3 Oncogene

  • AA Sequence

    LLSKFGSLAHLCGPGGVDHLPVKILQPAKADKESFEKAYQVGAVLGSGGFGTVYAGSRIADGLPVAVKHVVKERVTEWGSLGGATVPLEVVLLRKVGAAGGARGVIRLLDWFERPDGFLLVLERPEPAQDLFDFITERGALDEPLARRFFAQVLAAVRHCHSCGVVHRDIKDENLLVDLRSGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSATVWSLGVLLYDMVCGDIPFEQDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSERPSLDQIAAHPWMLGADGGVPESCDLRLCTLDPDDVASTTSSSESL

  • Predicted Molecular Mass

    60 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 5% glycerol, 5 mM DTT, 0.1 M Trehalose.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • PIM3 Protein, Human (Active, sf9, GST) Product Image
    1/16
  • PIM3 Protein, Human (Active, sf9, GST) Product Image