PIM3 Protein, Human (Active, sf9, GST)

The PIM3 protein is a serine/threonine kinase proto-oncogene that is crucial in preventing apoptosis, promoting cell survival, and protein translation in underlying tumorigenesis. It phosphorylates BAD, releases anti-apoptotic Bcl-X(L) and affects cell cycle, protein synthesis and MYC transcriptional activity, showing multifaceted effects on tumorigenesis. PIM3 Protein, Human (sf9, GST) is the recombinant human-derived PIM3 protein, expressed by sf9 insect cells , with N-GST labeled tag.

The PIM3 protein, a proto-oncogene with serine/threonine kinase activity, plays a pivotal role in preventing apoptosis and promoting cell survival and protein translation, potentially contributing to tumorigenesis through various mechanisms. It delivers survival signals by phosphorylating BAD, leading to the release of the anti-apoptotic protein Bcl-X(L). PIM3 regulates cell cycle progression, protein synthesis, and MYC transcriptional activity, highlighting its multifaceted impact on tumorigenesis. Additionally, it negatively regulates insulin secretion by inhibiting the activation of MAPK1/3 (ERK1/2) through SOCS6. Beyond its role in tumorigenesis, PIM3 is involved in the control of energy metabolism and regulates AMPK activity, modulating MYC and PPARGC1A protein levels and influencing cell growth.

The activity was measured by off-chip mobility shift assay(MSA). The enzyme was incubated with fluorecence-labeled substrate and Mg(or Mn)/ATP. The phosphorylated and unphosphorylated substrates were separated and detected by MSA device. When the protein concentration is 0.25 nM, the conversion rate is about 20%.

Human

Sf9 insect cells

N-GST

Q86V86 (L2-L326)

415116

Partial

LLSKFGSLAHLCGPGGVDHLPVKILQPAKADKESFEKAYQVGAVLGSGGFGTVYAGSRIADGLPVAVKHVVKERVTEWGSLGGATVPLEVVLLRKVGAAGGARGVIRLLDWFERPDGFLLVLERPEPAQDLFDFITERGALDEPLARRFFAQVLAAVRHCHSCGVVHRDIKDENLLVDLRSGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSATVWSLGVLLYDMVCGDIPFEQDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSERPSLDQIAAHPWMLGADGGVPESCDLRLCTLDPDDVASTTSSSESL

Approximately 60 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 5% glycerol, 5 mM DTT, 0.1 M Trehalose.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.