PLA2G12B Protein, Mouse (HEK293, His)
PLA2G12B Protein, Mouse (HEK293, His) is the recombinant mouse-derived PLA2G12B protein, expressed by HEK293, with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PLA2G12B Protein, Mouse (HEK293, His) is the recombinant mouse-derived PLA2G12B protein, expressed by HEK293, with C-His labeled tag.
Background
PLA2G12B is a protein with unknown function, and current research suggests that it does not appear to have catalytic activity.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
Q8VC81 (Q20-L195)
-
Molecular Construction
-
N-term
-
PLA2G12B (Q20-L195)
Accession # Q8VC81 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PLA2G12B; Group XIII Secretory Phospholipase A2-Like Protein; Prev. PLA2G13; Phospholipase A2, Group XIIB; Group XIIB Secretory Phospholipase A2-Like Protein; GXIII SPLA2-Like; Phospholipase A2, Group XIII; GXIIIsPLA2; SPLA2-GXIIB; FKSG71; GXIIB; Phosphol
-
AA Sequence
QSDPSPKEEESYSDWGLRQLRGSFESVNSYVDSFMELLGGKNGVCQYRCRYGKAPMPRPGYKAQEPNGCSSYFLGIKVPGSMDLGIPAMTKCCNQLDVCYDTCGANKYRCDAKFRWCLHSICSDLKRSLGFVSNVEAACDSLADTVFNTVWTLGCRPFMNSQRAACICAEEEKEEL
-
Predicted Molecular Mass
21 kDa
-
Molecular Weight
Approximately 24 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
