Plectin Protein, Human (HEK293, His)
Plectin Protein, Human (HEK293, His) is the recombinant human-derived Plectin protein, expressed by HEK293, with N-His tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Plectin Protein, Human (HEK293, His) is the recombinant human-derived Plectin protein, expressed by HEK293, with N-His tag.
Background
Plectin is a versatile cytoskeletal protein that interlinks intermediate filaments with microtubules and microfilaments, and anchors intermediate filaments to desmosomes or hemidesmosomes. It can also bind muscle proteins such as actin to membrane complexes, potentially playing a role in muscle function. Plectin may be involved not only in the filaments network organization but also in regulating their dynamics. As a structural component of muscle, its isoform 9 plays a major role in maintaining myofiber integrity.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-His
-
Accession
Q15149-1 (A4377-A4684)
-
Gene ID5339
-
Molecular Construction
-
N-term
-
His
-
PLEC (A4377-A4684)
Accession # Q15149-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
PLEC; LGMDR17; Prev. PLEC1; PLEC1b; Prev. EBS1; EBS5A; PLTN; EBS5B; PCN; EBS5C; Plectin 1, Intermediate Filament Binding Protein 500kDa; EBS5D; Hemidesmosomal Protein 1; EBSMD; Plectin-1; EBSND; HD1; EBSOG; Plectin 1, Intermediate Filament Binding Protein
-
AA Sequence
AGGFRSRSSSVGSSSSYPISPAVSRTQLASWSDPTEETGPVAGILDTETLEKVSITEAMHRNLVDNITGQRLLEAQACTGGIIDPSTGERFPVTDAVNKGLVDKIMVDRINLAQKAFCGFEDPRTKTKMSAAQALKKGWLYYEAGQRFLEVQYLTGGLIEPDTPGRVPLDEALQRGTVDARTAQKLRDVGAYSKYLTCPKTKLKISYKDALDRSMVEEGTGLRLLEAAAQSTKGYYSPYSVSGSGSTAGSRTGSRTGSRAGSRRGSFDATGSGFSMTFSSSSYSSSGYGRRYASGSSASLGGPESAVA
-
Predicted Molecular Mass
34.5 kDa
-
Molecular Weight
Approximately 43-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
