PLK1 Protein, Human (Inactive, T210V, sf9, His)
Based on 1 Customer Validation
PLK1 is a serine/threonine protein kinase that centrally coordinates key functions during the M phase of the cell cycle. It regulates centrosome maturation, spindle assembly, cohesin removal, inactivates APC/C inhibitors, and controls mitotic exit and cytokinesis. PLK1, Human (Inactive, T210V, sf9, His) is the recombinant human-derived PLK1 protein, expressed by sf9 insect cells, with N-Avi labeled tag.
- Species: Human
- Source: sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
PLK1 is a serine/threonine protein kinase that centrally coordinates key functions during the M phase of the cell cycle. It regulates centrosome maturation, spindle assembly, cohesin removal, inactivates APC/C inhibitors, and controls mitotic exit and cytokinesis. PLK1, Human (Inactive, T210V, sf9, His) is the recombinant human-derived PLK1 protein, expressed by sf9 insect cells, with N-Avi labeled tag.
Background
PLK1, a serine/threonine-protein kinase, plays a pivotal role in orchestrating various essential functions throughout the M phase of the cell cycle. It regulates centrosome maturation and spindle assembly, facilitates the removal of cohesins from chromosome arms, inactivates anaphase-promoting complex/cyclosome (APC/C) inhibitors, and governs mitotic exit and cytokinesis. Operating by binding and phosphorylating proteins that are already phosphorylated on specific motifs recognized by the POLO box domains, PLK1 phosphorylates an extensive array of substrates, including BORA, BUB1B/BUBR1, CCNB1, CDC25C, CEP55, ECT2, ERCC6L, FBXO5/EMI1, FOXM1, KIF20A/MKLP2, CENPU, NEDD1, NINL, NPM1, NUDC, PKMYT1/MYT1, PRC1, RACGAP1/CYK4, SGO1, STAG2/SA2, TEX14, TOPORS, p73/TP73, TPT1, WEE1, HNRNPU, and others. PLK1's crucial roles include promoting centrosome functions and bipolar spindle assembly through the phosphorylation of KIZ, NEDD1, and NINL. Additionally, it governs mitotic exit and cytokinesis by phosphorylating CEP55, ECT2, KIF20A/MKLP2, CENPU, PRC1, and RACGAP1. PLK1's involvement extends to kinetochore functions, sister chromatid cohesion, and the regulation of various checkpoint proteins, positioning it as a key player in the intricate network governing cell cycle progression.
Verified Bioactivity
The product demonstrated no detectable kinase activity measured by Caliper MSA kinase assay.
Technical Parameters
-
Species Human
-
Source sf9 insect cells
-
Tag N-His
-
Accession
P53350 (A13-K345, T210V)
-
Gene ID5347
-
Molecular Construction
-
N-term
-
His
-
(A13-K345, T210V)
Accession # P53350 -
C-term
-
-
Protein Length
Partial
-
Synonyms
PLK1; STPK13; Prev. PLK; Cell Cycle Regulated Protein Kinase; Serine/Threonine-Protein Kinase PLK1; Polo-Like Kinase (Drosophila); Polo-Like Kinase 1; Polo (Drosophia)-Like Kinase; Serine/Threonine-Protein Kinase 13; Polo Like Kinase 1; PLK-1
-
AA Sequence
APADPGKAGVPGVAAPGAPAAAPPAKEIPEVLVDPRSRRRYVRGRFLGKGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKVLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELLNDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNK
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM Tris, pH 7.5, 200 mM NaCl, 5% glycerol, 1 mM DTT.
Note: If this product is used in SPR assay, please note that the protein buffer should not contain primary amino components (such as Tris and Imidazole), and the buffer needs to be replaced.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)