Pollen allergen Phl p 5 Protein, Phleum pratense
The Pollen allergen Phl p 5 protein induces allergic reactions in humans, particularly contributing to grass pollen allergy. It is known to bind to immunoglobulin E (IgE) antibodies in individuals who are allergic to Phleum pratense (timothy grass), establishing a direct link between this allergen and the allergic responses observed in affected patients. Pollen allergen Phl p 5 Protein, Phleum pratense is the recombinant Pollen allergen Phl p 5 protein, expressed by E. coli , with tag free. Pollen allergen Phl p 5 Protein, Phleum pratense, has molecular weight of ~28.7 kDa.
- Species: Others
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The Pollen allergen Phl p 5 protein induces allergic reactions in humans, particularly contributing to grass pollen allergy. It is known to bind to immunoglobulin E (IgE) antibodies in individuals who are allergic to Phleum pratense (timothy grass), establishing a direct link between this allergen and the allergic responses observed in affected patients. Pollen allergen Phl p 5 Protein, Phleum pratense is the recombinant Pollen allergen Phl p 5 protein, expressed by E. coli , with tag free. Pollen allergen Phl p 5 Protein, Phleum pratense, has molecular weight of ~28.7 kDa.
Background
Pollen allergen Phl p 5 is a protein derived from grass pollen, specifically Phleum pratense (timothy grass). It is a potent allergen that induces allergic reactions in humans, particularly contributing to grass pollen allergy. Phl p 5 is known to bind to immunoglobulin E (IgE) antibodies present in individuals who are allergic to Phleum pratense. The interaction between Phl p 5 and IgE initiates an allergic response, leading to symptoms such as rhinitis, conjunctivitis, and asthma in susceptible individuals. Understanding the molecular characteristics and immunological reactivity of Phl p 5 is crucial for developing diagnostic tools and therapeutic strategies to manage grass pollen allergies.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag Tag Free
-
Accession
Q40960 (A26-V312)
-
Gene ID/
-
Molecular Construction
-
N-term
-
Phl p 5(A26-V312)
Accession # Q40960 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Pollen allergen Phl p 5.0101; Allergen Phl p 5a; Allergen Phl p V; Phl p 5.0101
-
AA Sequence
ADLGYGPATPAAPAAGYTPATPAAPAEAAPAGKATTEEQKLIEKINAGFKAALAAAAGVQPADKYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAFNDAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV
-
Predicted Molecular Mass
28.7 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
