PPIL1 Protein, Human (His)
Based on 1 Customer Validation
The PPIL1 protein is a spliceosome component that coordinates pre-mRNA splicing and controls RNA processing. As a peptidylprolyl cis-trans isomerase (PPIase), PPIL1 accelerates protein folding by catalyzing the cis-trans isomerization of proline imide peptide bonds. PPIL1 Protein, Human (His) is the recombinant human-derived PPIL1 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The PPIL1 protein is a spliceosome component that coordinates pre-mRNA splicing and controls RNA processing. As a peptidylprolyl cis-trans isomerase (PPIase), PPIL1 accelerates protein folding by catalyzing the cis-trans isomerization of proline imide peptide bonds. PPIL1 Protein, Human (His) is the recombinant human-derived PPIL1 protein, expressed by E. coli , with N-6*His labeled tag.
PPIL1 protein is intricately involved in pre-mRNA splicing as a vital component of the spliceosome, contributing to the complex machinery that governs RNA processing. Beyond its role in splicing regulation, PPIL1, as a peptidyl-prolyl cis-trans isomerase (PPIase), plays a key role in accelerating the folding of proteins. Notably, it catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides, showcasing its involvement in protein conformational changes. Specifically, PPIL1 catalyzes prolyl peptide bond isomerization in CDC40/PRP17, underscoring its specificity in mediating these crucial molecular interactions. Moreover, PPIL1 contributes to embryonic brain development, with its function in this context being independent of its isomerase activity, highlighting its multifaceted role in cellular processes.
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9Y3C6 (M1-G166)
-
Molecular Construction
-
N-term
-
6*His
-
PPIL1 (M1-G166)
Accession # Q9Y3C6 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
PPIL1; PPIase; Peptidylprolyl Isomerase Like 1; Peptidyl-Prolyl Cis-Trans Isomerase; CYPL1; Cyclophilin-Related Gene 1; Peptidylprolyl Isomerase (Cyclophilin)-Like 1; CGI-124; Peptidyl-Prolyl Cis-Trans Isomerase-Like 1; PCH14; Cyclophilin Like 1; HCyPX; R
-
AA Sequence
MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG
-
Predicted Molecular Mass
20.4 kDa
-
Molecular Weight
Approximately 23 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
