PPP1CB Protein, Human (Active, sf9, GST)
PPP1CB Protein, Human (Active, sf9, GST) is the recombinant human-derived PPP1CB protein, expressed by Sf9 insect cells, with N-GST tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
PPP1CB Protein, Human (Active, sf9, GST) is the recombinant human-derived PPP1CB protein, expressed by Sf9 insect cells, with N-GST tag.
Background
PP1α/β is a protein phosphatase that forms highly specific holoenzymes by associating with over 200 regulatory proteins, targeting hundreds of biological substrates for dephosphorylation. It plays essential roles in cell division, glycogen metabolism, muscle contractility, and protein synthesis, while also regulating ionic conductances and long-term synaptic plasticity. As part of the PTW/PP1 phosphatase complex, PP1α/β contributes to chromatin structure modulation and cell cycle progression during the mitosis-to-interphase transition. Together with CSNK1D and CSNK1E, it determines circadian period length by regulating the phosphorylation rhythm and speed of PER1 and PER2. It may dephosphorylate CSNK1D and CSNK1E. In rheumatoid arthritis patients' regulatory T-cells (Treg), PP1α/β inactivates FOXP3 by dephosphorylating its 'Ser-418' residue, impairing Treg function. Additionally, PP1α/β serves as the core component of the SHOC2-MRAS-PP1c (SMP) holophosphatase complex, which stimulates MAPK pathway activation by dephosphorylating inhibitory sites ('Ser-259' of RAF1, 'Ser-365' of BRAF, and 'Ser-214' of ARAF), enhancing PP1c's substrate specificity and activity.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-GST
-
Accession
P62140 (M1-R327)
-
Gene ID5500
-
Molecular Construction
-
N-term
-
GST
-
PPP1CB (M1-R327)
Accession # P62140 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
PPP1CB; Myosin Phosphatase; Protein Phosphatase 1 Catalytic Subunit Beta; PP1Cdelta; PP-1B; PP1Cbeta; PPP1beta; Protein Phosphatase 1, Catalytic Subunit, Beta Isoform; PP1beta; Epididymis Secretory Sperm Binding Protein Li 80p; PPP1CD; Protein-Serine/Thre
-
AA Sequence
MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR
-
Predicted Molecular Mass
60 kDa
-
Molecular Weight
Approximately 60 kDa, based on SDS-PAGE under reducing conditions.
-
Structure/Form
Monomer
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)