PPP2R2A Protein, Human (His)
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P63151-1 (A2-N447)
-
Gene ID5520
-
Molecular Construction
-
N-term
-
6*His
-
PPP2R2A (A2-N447)
Accession # P63151 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
PPP2R2A; PP2A Subunit B Isoform Alpha; Protein Phosphatase 2 Regulatory Subunit Balpha; B55; PR55alpha; Protein Phosphatase 2 (Formerly 2A), Regulatory Subunit B (PR 52), Alpha Isoform; B55alpha; Serine/Threonine-Protein Phosphatase 2A 55 KDa Regulatory S
-
AA Sequence
AGAGGGNDIQWCFSQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQENKIQSHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQKNAAQFLLSTNDKTIKLWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHINSISINSDYETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPNSCNTFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSFFSEIISSISDVKFSHSGRYMMTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTGSYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKILHTAWHPKENIIAVATTNNLYIFQDKVN
-
Predicted Molecular Mass
58.5 kDa
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)