Copy Link Print Information

Betacellulin/BTC Protein, Mouse (HEK293)

Probetacellulin Protein, Mouse (HEK293), a member of the epidermal growth factor (EGF) family, induces differentiation of pancreatic β-cells and promotes regeneration of β-cells in experimental diabetes.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Betacellulin/BTC Protein, Mouse (HEK293) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Probetacellulin Protein, Mouse (HEK293), a member of the epidermal growth factor (EGF) family, induces differentiation of pancreatic β-cells and promotes regeneration of β-cells in experimental diabetes.

Background

Betacellulin (BTC), a member of the epidermal growth factor (EGF) family, induces differentiation of pancreatic β-cells and promotes regeneration of β-cells in experimental diabetes. BTC stimulates DNA synthesis in fibroblasts and vascular smooth muscle cells. BTC plays a role in regulating growth and/or differentiation of endocrine precursor cells of the fetal pancreas. BTC is found to convert amylase-secreting pancreatic AR42J cells into insulin-producing cells and to have a mitogenic effect in human undifferentiated pancreatic epithelial cells[1].

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag Tag Free
  • Accession

    Q05928 (D32-Y111)

  • Gene ID
    12223  [NCBI]
  • Molecular Construction
    • N-term
    • BTC (D32-Y111)
      Accession # Q05928
    • C-term
  • Protein Length

    Full Length of Betacellulin Chain

  • Synonyms

    BTC; Probetacellulin; Betacellulin; Betacellulin Isoform 2

  • AA Sequence

    DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFY

  • Molecular Weight

    Approximately 19-24 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Li L, et al. Betacellulin improves glucose metabolism by promoting conversion of intraislet precursor cells to beta-cells in streptozotocin-treated mice. Am J Physiol Endocrinol Metab. 2003 Sep;285(3):E577-83. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Betacellulin/BTC Protein, Mouse (HEK293) Product Image
    1/16
  • Betacellulin/BTC Protein, Mouse (HEK293) Product Image