1. Recombinant Proteins
  2. Others
  3. PRSS2/Trypsin-2 Protein, Mouse (HEK293, His)

PRSS2 Protein plays an important role in the metastasis and recurrence of multiple tumor types through its actions of destroying the ECM and activating MMPs. PRSS2/Trypsin-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived PRSS2/Trypsin-2 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PRSS2 Protein plays an important role in the metastasis and recurrence of multiple tumor types through its actions of destroying the ECM and activating MMPs. PRSS2/Trypsin-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived PRSS2/Trypsin-2 protein, expressed by HEK293 , with C-His labeled tag.

Background

PRSS2 Protein plays an important role in the metastasis and recurrence of multiple tumor types through its actions of destroying the ECM and activating MMPs. PRSS2 enables calcium ion binding activity and serine-type endopeptidase activity. PRSS2 is involved in proteolysis, response to caffeine and response to nicotine.PRSS2 acst upstream of or within digestion[1][2][3].

Biological Activity

Measured by its ability to cleave the fluorogenic peptide substrate, Mca- RPKPVE-Nval-WRK(Dnp)-NH2. The specific activity is >1500 pmoles/min/μg.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q792Y6 (F16-N246)

Gene ID
Molecular Construction
N-term
PRSS2 (F16-N246)
Accession # Q792Y6
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Trypsin-2; Anionic trypsinogen; Serine protease 2; Trypsin II; PRSS2; TRY2; TRYP2
AA Sequence

FPVDDDDKIVGGYTCRESSVPYQVSLNAGYHFCGGSLINDQWVVSAAHCYKYRIQVRLGEHNINVLEGNEQFVDSAKIIRHPNYNSWTLDNDIMLIKLASPVTLNARVASVPLPSSCAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLPQADCEASYPGDITNNMICVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQPDAPGVYTKVCNYVDWIQNTIADN

Predicted Molecular Mass
26.2 kDa
Molecular Weight

Approximately 32 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 22.5% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PRSS2/Trypsin-2 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PRSS2/Trypsin-2 Protein, Mouse (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PRSS2/Trypsin-2 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P75984
Quantity:
MCE Japan Authorized Agent: