PRTN3 Protein, Human (S203A, HEK293, His)
Based on 1 Customer Validation
PRTN3 is a serine protease that broadly targets elastin, fibronectin, laminin, vitronectin, and collagen types I, III, and IV in vitro, playing a crucial role in extracellular matrix degradation. It modulates endothelial cell barrier function by cleaving and activating the receptor F2RL1/PAR-2 and enhances vascular integrity during neutrophil transendothelial migration. PRTN3 Protein, Human (S203A, HEK293, His) is the recombinant human-derived PRTN3 protein, expressed by HEK293 , with C-His labeled tag and S203A mutation.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PRTN3 is a serine protease that broadly targets elastin, fibronectin, laminin, vitronectin, and collagen types I, III, and IV in vitro, playing a crucial role in extracellular matrix degradation. It modulates endothelial cell barrier function by cleaving and activating the receptor F2RL1/PAR-2 and enhances vascular integrity during neutrophil transendothelial migration. PRTN3 Protein, Human (S203A, HEK293, His) is the recombinant human-derived PRTN3 protein, expressed by HEK293 , with C-His labeled tag and S203A mutation.
Background
PRTN3, a serine protease, exhibits a broad substrate specificity, targeting elastin, fibronectin, laminin, vitronectin, and collagen types I, III, and IV in vitro. Its enzymatic activity plays a crucial role in the degradation of these extracellular matrix components. Additionally, PRTN3 takes part in the modulation of endothelial cell barrier function by cleaving and activating the receptor F2RL1/PAR-2, thereby enhancing vascular integrity during neutrophil transendothelial migration. Notably, its potential involvement in neutrophil transendothelial migration is suggested, particularly when associated with CD177, emphasizing its significance in immune-related processes.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P24158 (I28-P256, S203A)
-
Molecular Construction
-
N-term
-
PRTN3 (I28-P256, S203A)
Accession # P24158 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein (with Propeptide)
-
Synonyms
PRTN3; Neutrophil Proteinase 4; Proteinase 3; Leukocyte Proteinase 3; AGP7; Wegener Autoantigen; PR-3; C-ANCA Antigen; P29; NP-4; Myeloblastin; MBN; C-ANCA; PR3; ACPA; Azurophil Granule Protein 7; MBT; CANCA; Wegener Granulomatosis Autoantigen; NP4; Serin
-
AA Sequence
IVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDAGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRRVEAKGRP
-
Predicted Molecular Mass
26.6 kDa
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
