PSAT1 Protein, Human (N-His)

The PSAT1 protein plays a central role in cellular metabolism by catalyzing the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and 3-hydroxy-2-oxo-4-phosphonooxybutyrate to phosphohydroxythreonine. These enzyme activities are key steps in the biosynthetic pathway of the essential amino acids serine and threonine. PSAT1 Protein, Human (N-His) is the recombinant human-derived PSAT1 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The PSAT1 protein plays a central role in cellular metabolism by catalyzing the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and 3-hydroxy-2-oxo-4-phosphonooxybutyrate to phosphohydroxythreonine. These enzyme activities are key steps in the biosynthetic pathway of the essential amino acids serine and threonine. PSAT1 Protein, Human (N-His) is the recombinant human-derived PSAT1 protein, expressed by E. coli , with N-6*His labeled tag.

Background

The PSAT1 (Phosphoserine aminotransferase 1) protein is an enzyme that catalyzes the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and 3-hydroxy-2-oxo-4-phosphonooxybutanoate to phosphohydroxythreonine. This enzymatic activity is a key step in the serine biosynthetic pathway, contributing to the synthesis of essential amino acids and cellular processes such as nucleotide and protein biosynthesis. Phosphoserine and phosphohydroxythreonine generated by PSAT1 serve as precursors for the production of serine and glycine, both of which are crucial for various metabolic pathways and cellular functions. PSAT1's role in serine biosynthesis underscores its importance in maintaining cellular homeostasis and provides potential insights into therapeutic approaches for conditions involving dysregulated amino acid metabolism.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • PSAT1 (L17-L370)
      Accession # Q9Y617-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    PSAT1; Phosphoserine Transaminase; Phosphoserine Aminotransferase 1; Endometrial Progesterone-Induced Protein; PSAT; PSATD; PSA; NLS2; Phosphoserine Aminotransferase; EPIP; Phosphohydroxythreonine Aminotransferase

  • AA Sequence

    LPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQL

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00