1. Recombinant Proteins
  2. Others
  3. PSCA Protein, Human (HEK293, Fc)

PSCA protein plays a role in the regulation of cell proliferation and has shown an inhibitory effect on cell proliferation in vitro. In addition, PSCA may act as a modulator of nicotinic acetylcholine receptor (nAChR) activity, specifically inhibiting nicotine-induced signaling in vitro, possibly affecting α-3:β-2 or α-7-containing nAChRs. PSCA Protein, Human (HEK293, Fc) is the recombinant human-derived PSCA protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PSCA protein plays a role in the regulation of cell proliferation and has shown an inhibitory effect on cell proliferation in vitro. In addition, PSCA may act as a modulator of nicotinic acetylcholine receptor (nAChR) activity, specifically inhibiting nicotine-induced signaling in vitro, possibly affecting α-3:β-2 or α-7-containing nAChRs. PSCA Protein, Human (HEK293, Fc) is the recombinant human-derived PSCA protein, expressed by HEK293 , with N-hFc labeled tag.

Background

The PSCA protein appears to play a role in the regulation of cell proliferation, exhibiting cell-proliferation inhibition activity in vitro. Additionally, PSCA may serve as a modulator of nicotinic acetylcholine receptors (nAChRs) activity, particularly in vitro where it inhibits nicotine-induced signaling, potentially implicating alpha-3:beta-2- or alpha-7-containing nAChRs. This dual functionality suggests PSCA's involvement in cellular processes related to proliferation control and the modulation of nicotinic acetylcholine receptor activity, underscoring its potential significance in cellular physiology and signaling pathways.

Biological Activity

Immobilized Human PSCA, hFc Tag at 2 μg/mL (100 μl/Well) on the plate. Dose response curve for Biotinylated Anti-PSCA Ab., hFc Tag with the EC50 of ≤117.3 ng/mL determined by ELISA.

Species

Human

Source

HEK293

Tag

N-hFc

Accession

O43653 (L12-S86)

Gene ID
Molecular Construction
N-term
hFc
PSCA (L12-S86)
Accession # O43653
C-term
Protein Length

Partial

Synonyms
PSCA; UNQ206; PRO232
AA Sequence

LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS

Molecular Weight

Approximately 40-55 kDa

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PSCA Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PSCA Protein, Human (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PSCA Protein, Human (HEK293, Fc)
Cat. No.:
HY-P78013
Quantity:
MCE Japan Authorized Agent: