PSCA Protein, Human (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

PSCA protein plays a role in the regulation of cell proliferation and has shown an inhibitory effect on cell proliferation in vitro. In addition, PSCA may act as a modulator of nicotinic acetylcholine receptor (nAChR) activity, specifically inhibiting nicotine-induced signaling in vitro, possibly affecting α-3:β-2 or α-7-containing nAChRs. PSCA Protein, Human (HEK293, Fc) is the recombinant human-derived PSCA protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PSCA protein plays a role in the regulation of cell proliferation and has shown an inhibitory effect on cell proliferation in vitro. In addition, PSCA may act as a modulator of nicotinic acetylcholine receptor (nAChR) activity, specifically inhibiting nicotine-induced signaling in vitro, possibly affecting α-3:β-2 or α-7-containing nAChRs. PSCA Protein, Human (HEK293, Fc) is the recombinant human-derived PSCA protein, expressed by HEK293 , with N-hFc labeled tag.

Background

The PSCA protein appears to play a role in the regulation of cell proliferation, exhibiting cell-proliferation inhibition activity in vitro. Additionally, PSCA may serve as a modulator of nicotinic acetylcholine receptors (nAChRs) activity, particularly in vitro where it inhibits nicotine-induced signaling, potentially implicating alpha-3:beta-2- or alpha-7-containing nAChRs. This dual functionality suggests PSCA's involvement in cellular processes related to proliferation control and the modulation of nicotinic acetylcholine receptor activity, underscoring its potential significance in cellular physiology and signaling pathways.

Verified Bioactivity

Immobilized Human PSCA, hFc Tag at 2 μg/mL (100 μl/Well) on the plate. Dose response curve for Biotinylated Anti-PSCA Ab., hFc Tag with the EC50 of ≤117.3 ng/mL determined by ELISA.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • hFc
    • PSCA (L12-S86)
      Accession # O43653
    • C-term
  • Protein Length

    Partial

  • Synonyms

    PSCA; LncPSCA; Prostate Stem Cell Antigen; PRO232

  • AA Sequence

    LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS

  • Predicted Molecular Mass

    34.3 kDa

  • Molecular Weight

    Approximately 40-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00