PSMG4 Protein, Human
PSMG4 protein functions as a chaperone, facilitating the assembly of the 20S proteasome. In its role as a chaperone, PSMG4 interacts with PSMG3, forming a functional complex that contributes to the proper assembly of the 20S proteasome. Notably, PSMG4 associates specifically with the alpha subunits of the 20S proteasome, highlighting its involvement in the intricate process of proteasomal maturation and functionality. PSMG4 Protein, Human is the recombinant human-derived PSMG4 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
PSMG4 protein functions as a chaperone, facilitating the assembly of the 20S proteasome. In its role as a chaperone, PSMG4 interacts with PSMG3, forming a functional complex that contributes to the proper assembly of the 20S proteasome. Notably, PSMG4 associates specifically with the alpha subunits of the 20S proteasome, highlighting its involvement in the intricate process of proteasomal maturation and functionality. PSMG4 Protein, Human is the recombinant human-derived PSMG4 protein, expressed by E. coli , with tag free.
PSMG4 (Proteasome assembly chaperone 4) is a chaperone protein that plays a crucial role in promoting the assembly of the 20S proteasome. Functioning in collaboration with PSMG3, PSMG4 facilitates the proper formation and maturation of the 20S proteasome, an essential component of the cellular protein degradation machinery. Notably, PSMG4 interacts with the alpha subunits of the 20S proteasome, indicating its involvement in coordinating the assembly of this multi-subunit complex. The chaperone activity of PSMG4 underscores its significance in ensuring the proper functioning and structural integrity of the 20S proteasome, contributing to the cell's ability to regulate protein turnover and maintain cellular homeostasis. It has to highlight PSMG4's role as a chaperone protein in promoting the assembly of the 20S proteasome and its interaction with both PSMG3 and the alpha subunits of the proteasome.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q5JS54 (M1-F123)
-
Gene ID389362
-
Molecular Construction
-
N-term
-
PSMG4 (M1-F123)
Accession # Q5JS54 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
PSMG4; Pba4; Prev. C6orf86; BA506K6.2; PAC4; HPAC4; Proteasome (Prosome, Macropain) Assembly Chaperone 4; PAC-4; Proteasome Chaperone Homolog 4; Proteasome Assembly Chaperone 4; Chromosome 6 Open Reading Frame 86
-
AA Sequence
MEGLVVAAGGDVSLHNFSARLWEQLVHFHVMRLTDSLFLWVGATPHLRNLAVAMCSRYDSIPVSTSLLGDTSDTTSTGLAQRLARKTNKQVFVSYNLQNTDSNFALLVENRIKEEMEAFPEKF
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
