PTH Protein, Cynomolgus (HEK293, hFc)
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Technical Parameters
-
Product Properties
- Help & FAQs
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-hFc
-
Accession
Q9XT35 (S32-Q115)
-
Gene ID102145320
-
Molecular Construction
-
N-term
-
PTH (S32-Q115)
Accession # Q9XT35 -
hFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PTH; Preproparathyroid Hormone; Parathyroid Hormone; Parathyroid Hormone 1; Parathormone; Prepro-PTH; Parathyrin; FIH1; PTH1
-
AA Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFIALGAPLAPRDAGSQRPRKKEDNILVESHEKSLGEADKADVDVLTKAKSQ
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
