PTH Protein, Human
Based on 1 Customer Validation
PTH Protein, Human is a major regulator of mineral ion metabolism.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
PTH Protein, Human is a major regulator of mineral ion metabolism.
Background
Recombinant Human Parathyroid Hormone is a replica of the endogenous Parathyroid hormone molecule. Parathyroid Hormone regulates calcium and phosphorus levels by acting on the bone, kidneys and intestines. In the bone, Parathyroid hormone mobilizes calcium and phosphorus into the circulation by stimulating bone resorption. Parathyroid hormone stimulates osteoblasts to increase the expression of receptor activator of nuclear factor j-B ligand (RANKL)[1].
Verified Bioactivity
1.PTH is fully biologically active when compared to standards. The activity calculated by UMR106 cell/cAMP method corresponding to a specifc activity of 1.0×104 U/mg.
2.Measured by its ability to induce cAMP accumulation in MC3T3-E1 mouse preosteoblast cells. The ED50 for this effect is < 60 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P01270 (S32-Q115)
-
Molecular Construction
-
N-term
-
PTH (S32-Q115)
Accession # P01270 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PTH; Preproparathyroid Hormone; Parathyroid Hormone; Parathyroid Hormone 1; Parathormone; Prepro-PTH; Parathyrin; FIH1; PTH1
-
AA Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
-
Molecular Weight
14 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of 10 mM HAc-NaAc, 150 mM NaCl, 5% mannitol, pH 4.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)