1. Recombinant Proteins
  2. PTH Protein, Human

PTH Protein, Human

Cat. No.: HY-P7112
Handling Instructions

PTH Protein, Human is a major regulator of mineral ion metabolism.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $70 In-stock
Estimated Time of Arrival: December 31
50 μg $210 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuPTH; Parathormone; Parathyrin
Species

Human

Source

E. coli

Accession

P01270 (S32-Q115)

Gene ID

5741

Molecular Weight

Approximately 9,000 Da

AA Sequence

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ

Biological Activity
The ED50 is <0.1 μg/mL as measured by UMR106 cell/cAMP method, corresponding to a specific activity of >1.0 × 104 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 1.15 mg sodium citrate, sodium chloride 7.31 mg, 0.21 mg citric acid, 0.1117 mg EDTA-Na2, 0.2 mg Tween 80 and 50 mg Mannitol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Recombinant Human Parathyroid Hormone, 1-84a.a. is a full-length replica of the endogenous Parathyroid hormone molecule, which consists of an amino (N)-terminal structure (first 34 amino acids) and a carboxyl (C)-terminal structure (last 50 amino acids). Full-length recombinant human parathyroid hormone [rhPTH (1-84); Natpara] is approved in the USA as an adjunct to calcium and vitamin D therapy for control of hypocalcaemia in patients with hypoparathyroidism. Parathyroid Hormone regulates calcium and phosphorus levels by acting on the bone, kidneys and intestines. In the bone, Parathyroid hormone mobilizes calcium and phosphorus into the circulation by stimulating bone resorption. Parathyroid hormone stimulates osteoblasts to increase the expression of receptor activator of nuclear factor j-B ligand (RANKL)[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PTH Protein, Human
Cat. No.:
HY-P7112
Quantity:
MCE Japan Authorized Agent: