Copy Link Print Information

PTH Protein, Human (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

PTH Protein, or parathyroid hormone, raises calcium levels by dissolving bone salts and inhibiting kidney excretion. It also stimulates [1-14C]-2-deoxy-D-glucose transport and glycogen synthesis in osteoblastic cells, interacting with the PTH1R receptor and binding to its N-terminal extracellular domain for these effects. PTH Protein, Human (HEK293, His) is the recombinant human-derived PTH protein, expressed by HEK293 , with N-8*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for PTH Protein, Human (HEK293, His)
  • Experimental Validation Results for PTH Protein, Human (HEK293, His)
  • PTH Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

PTH Protein, or parathyroid hormone, raises calcium levels by dissolving bone salts and inhibiting kidney excretion. It also stimulates [1-14C]-2-deoxy-D-glucose transport and glycogen synthesis in osteoblastic cells, interacting with the PTH1R receptor and binding to its N-terminal extracellular domain for these effects. PTH Protein, Human (HEK293, His) is the recombinant human-derived PTH protein, expressed by HEK293 , with N-8*His labeled tag.

Background

PTH, or parathyroid hormone, functions to increase calcium levels by facilitating the dissolution of bone salts and inhibiting their excretion by the kidneys. Additionally, it stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and promotes glycogen synthesis in osteoblastic cells. PTH achieves these effects through its interaction with the PTH1R receptor, specifically binding to the N-terminal extracellular domain of the receptor.

Verified Bioactivity

Measured by its ability to alkaline phosphatase production by MC3T3-E1 mouse preosteoblast cells.  The ED50 this effect is 7.273 ng/mL, corresponding to a specific activity is 1.375×105 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to alkaline phosphatase production by MC3T3-E1 mouse preosteoblast cells. The ED50 for this effect is 8.814 ng/mL, corresponding to a specific activity is 1.135×105 units/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-8*His
  • Accession

    P01270 (S32-Q115)

  • Gene ID
    5741  [NCBI]
  • Molecular Construction
    • N-term
    • 8*His
    • PTH (S32-Q115)
      Accession # P01270
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    PTH; Preproparathyroid Hormone; Parathyroid Hormone; Parathyroid Hormone 1; Parathormone; Prepro-PTH; Parathyrin; FIH1; PTH1

  • AA Sequence

    SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ

  • Molecular Weight

    Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to alkaline phosphatase production by MC3T3-E1 mouse preosteoblast cells. The ED50 for this effect is 8.814 ng/mL, corresponding to a specific activity is 1.135×105 units/mg.

  • PTH Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for PTH Protein, Human (HEK293, His)
  • Experimental Validation Results for PTH Protein, Human (HEK293, His)
  • PTH Protein, Human (HEK293, His) Product Image