PTRH2 Protein, Human (His)
Based on 1 Customer Validation
PTRH2, an enzyme with potential peptidyl-tRNA affinity, promotes caspase-independent apoptosis. It regulates transcriptional regulators AES and TLE1, contributing to the intricate machinery governing apoptotic processes. PTRH2 Protein, Human (His) is the recombinant human-derived PTRH2 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
PTRH2, an enzyme with potential peptidyl-tRNA affinity, promotes caspase-independent apoptosis. It regulates transcriptional regulators AES and TLE1, contributing to the intricate machinery governing apoptotic processes. PTRH2 Protein, Human (His) is the recombinant human-derived PTRH2 protein, expressed by E. coli , with N-His labeled tag.
PTRH2, an enzyme with a potential affinity for peptidyl-tRNAs that dissociate from the ribosome during protein synthesis, is implicated in the promotion of caspase-independent apoptosis. Its regulatory role extends to the modulation of two transcriptional regulators, AES and TLE1, contributing to the intricate machinery that governs apoptotic processes.
Measured by its ability to inhibit chemoattract of A549 Human non-small cell lung cancer cells. The ED50 for this effect is 0.1557 μg/mL, corresponding to a specific activity is 6.422×103 U/mg.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q9Y3E5 (G63-Y179)
-
Molecular Construction
-
N-term
-
His
-
PTRH2 (G63-Y179)
Accession # Q9Y3E5 -
C-term
-
-
Protein Length
Partial
-
Synonyms
PTRH2; CFAP37; Peptidyl-TRNA Hydrolase 2; Cilia And Flagella Associated Protein 37; BIT1; Bcl-2 Inhibitor Of Transcription 1; PTH2; PTH 2; Peptidyl-TRNA Hydrolase 2, Mitochondrial; Bcl-2 Inhibitor Of Transcription; CGI-147; IMNEPD
-
AA Sequence
GEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY
-
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0, 10% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
