Pyridoxal Kinase Protein, Human (GST)

Pyridoxal Kinase Protein catalyzes vitamin B6 vitamer phosphorylation—converting pyridoxal (PL), pyridoxine (PN), and pyridoxamine (PM) into active forms: pyridoxal 5'-phosphate (PLP), pyridoxine 5'-phosphate (PNP), and pyridoxamine 5'-phosphate (PMP) (Probable). PLP serves as the active cofactor in more than 140 enzymatic reactions. Pyridoxal Kinase Protein, Human (His) is the recombinant human-derived Pyridoxal Kinase protein, expressed by E. coli , with N-GST labeled tag.

The Pyridoxal Kinase protein plays a pivotal role in cellular metabolism by catalyzing the phosphorylation of the dietary vitamin B6 vitamers pyridoxal (PL), pyridoxine (PN), and pyridoxamine (PM) to generate their respective phosphorylated forms: pyridoxal 5'-phosphate (PLP), pyridoxine 5'-phosphate (PNP), and pyridoxamine 5'-phosphate (PMP), as supported by various studies. PLP, the active form of vitamin B6, serves as a crucial cofactor in over 140 different enzymatic reactions, underscoring the significance of Pyridoxal Kinase in facilitating the conversion of vitamin B6 vitamers into their bioactive forms essential for a myriad of cellular processes.

Human

E. coli

N-GST

O00764-1 (M1-L312)

8566  [NCBI]

Full Length

MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.