Pyridoxal Kinase Protein, Human (GST)
Pyridoxal Kinase Protein catalyzes vitamin B6 vitamer phosphorylation—converting pyridoxal (PL), pyridoxine (PN), and pyridoxamine (PM) into active forms: pyridoxal 5'-phosphate (PLP), pyridoxine 5'-phosphate (PNP), and pyridoxamine 5'-phosphate (PMP) (Probable). PLP serves as the active cofactor in more than 140 enzymatic reactions. Pyridoxal Kinase Protein, Human (His) is the recombinant human-derived Pyridoxal Kinase protein, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Pyridoxal Kinase Protein catalyzes vitamin B6 vitamer phosphorylation—converting pyridoxal (PL), pyridoxine (PN), and pyridoxamine (PM) into active forms: pyridoxal 5'-phosphate (PLP), pyridoxine 5'-phosphate (PNP), and pyridoxamine 5'-phosphate (PMP) (Probable). PLP serves as the active cofactor in more than 140 enzymatic reactions. Pyridoxal Kinase Protein, Human (His) is the recombinant human-derived Pyridoxal Kinase protein, expressed by E. coli , with N-GST labeled tag.
Background
The Pyridoxal Kinase protein plays a pivotal role in cellular metabolism by catalyzing the phosphorylation of the dietary vitamin B6 vitamers pyridoxal (PL), pyridoxine (PN), and pyridoxamine (PM) to generate their respective phosphorylated forms: pyridoxal 5'-phosphate (PLP), pyridoxine 5'-phosphate (PNP), and pyridoxamine 5'-phosphate (PMP), as supported by various studies. PLP, the active form of vitamin B6, serves as a crucial cofactor in over 140 different enzymatic reactions, underscoring the significance of Pyridoxal Kinase in facilitating the conversion of vitamin B6 vitamers into their bioactive forms essential for a myriad of cellular processes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
O00764-1 (M1-L312)
-
Molecular Construction
-
N-term
-
GST
-
PDXK (M1-L312)
Accession # O00764-1 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
PDXK; FLJ31940; Prev. C21orf124; Epididymis Secretory Sperm Binding Protein Li 1a; Prev. C21orf97; Chromosome 21 Open Reading Frame 124; Pyridoxine Kinase; Chromosome 21 Open Reading Frame 97; PKH; HCG401289, Isoform CRA_e; PNK; Pyridoxamine Kinase; PRED7
-
AA Sequence
MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL
-
Predicted Molecular Mass
62.1 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O . For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
