QPCT Protein, Mouse (His)

Revisión del cliente

Based on 1 Customer Validation

The QPCT protein plays a key role in pyroglutamyl peptide biosynthesis and exhibits substrate preference for N-terminal glutamine residues while showing specificity for residues near the N-terminus. Notably, its catalytic activity is independent of chain length beyond the second residue, emphasizing the importance of QPCT in the precise biosynthesis of pyroglutamyl peptides with diverse N-termini, contributing to various biological background. QPCT Protein, Mouse (His) is the recombinant mouse-derived QPCT protein, expressed by E. coli , with N-6*His tag.

Para uso exclusivo en investigación. No vendemos a pacientes.
  • Species: Mouse
  • Source: E. coli
  • Almacenamiento:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Actividad biológica
  • Technical Parameters
  • Product Properties
  • Documentación
  • Help & FAQs

Actividad biológica

Descripciòn

The QPCT protein plays a key role in pyroglutamyl peptide biosynthesis and exhibits substrate preference for N-terminal glutamine residues while showing specificity for residues near the N-terminus. Notably, its catalytic activity is independent of chain length beyond the second residue, emphasizing the importance of QPCT in the precise biosynthesis of pyroglutamyl peptides with diverse N-termini, contributing to various biological background. QPCT Protein, Mouse (His) is the recombinant mouse-derived QPCT protein, expressed by E. coli , with N-6*His tag.

Background

The QPCT protein plays a pivotal role in the biosynthesis of pyroglutamyl peptides, exhibiting a preference for substrates with an N-terminal glutaminyl residue while displaying a bias against adjacent acidic and tryptophan residues. Notably, its substrate specificity is more pronounced for the residues proximal to the N-terminal glutaminyl residue, showing a distinctive substrate recognition pattern. Additionally, QPCT demonstrates a lack of significant dependence on chain length beyond the second residue, suggesting that the protein's catalytic activity is less influenced by elongation beyond this point. This selectivity and flexibility in substrate recognition highlight QPCT's significance in the precise biosynthesis of pyroglutamyl peptides, contributing to the diverse array of peptides with pyroglutamylated N-termini in various biological contexts.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • QPCT (A36-L362)
      Accession # Q9CYK2-1
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    QPCT; GCT; Glutaminyl-Peptide Cyclotransferase; Glutamyl Cyclase; Glutaminyl Cyclase; SQC; QC; EC; Glutaminyl-TRNA Cyclotransferase

  • AA Sequence

    AWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDVSGSKPDLSLRLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLLKDHSLERKYFQNFGYGNIIQDDHIPFLRKGVPVLHLIASPFPEVWHTMDDNEENLHASTIDNLNKIIQVFVLEYLHL

  • Predicted Molecular Mass

    38.4 kDa

  • Peso molecular

    Approximately 36 kDa, based on SDS-PAGE under reducing conditions.

  • Pureza

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Calculadora de dilución

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Obtener un presupuesto En stock

Other size
Obtener un presupuesto
Please select quantity
Amount: USD 0.00