RAB29 Protein, Human (GST)
RAB29 Protein, Human (GST) is the recombinant human-derived RAB29, expressed by E. coli , with GST labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
RAB29 Protein, Human (GST) is the recombinant human-derived RAB29, expressed by E. coli , with GST labeled tag. ,
RAB29 is a small GTPase that serves as a key regulator in vesicle trafficking. It is essential for maintaining the structural integrity of the endosome-trans-Golgi network (by similarity). In collaboration with LRRK2, RAB29 participates in the retromer-dependent retrograde trafficking pathway, recycling proteins such as the mannose 6 phosphate receptor (M6PR) between lysosomes and the Golgi apparatus. Additionally, RAB29 recruits LRRK2 to the Golgi complex and enhances its kinase activity, promoting LRRK2-mediated phosphorylation of RAB10 at Thr-73. Within the intact central nervous system (CNS), RAB29 regulates neuronal process morphology (by similarity). Studies also suggest a potential role for RAB29 in the formation of typhoid toxin transport intermediates during Salmonella enterica serovar Typhi (S. typhi) infection of epithelial cells.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag GST
-
Accession
O14966-1 (M1-S177, Q67L, T71A, S72A)
-
Gene ID8934
-
Protein Length
Partial
-
Synonyms
RAB29; Ras-Related Protein Rab-7L1; Prev. RAB7L1; Rab-7-Like Protein 1; Prev. RAB7L; Ras-Related Protein Rab; RAB7, Member RAS Oncogene Family-Like 1; RAB29, Member RAS Oncogene Family; Ras-Related Protein Rab-29
-
AA Sequence
MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGLERFAAMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLIEKMMRNS
-
Predicted Molecular Mass
47 kDa
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
