REG-3 gamma/REG3G Protein, Mouse (P. pastoris, His)
- Species: Mouse
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Technical Parameters
-
Species Mouse
-
Source P. pastoris
-
Tag N-6*His
-
Accession
O09049 (E27-A174)
-
Gene ID19695
-
Molecular Construction
-
N-term
-
Reg3g (E27-A174)
Accession # O09049 -
6*His
-
C-term
-
-
Protein Length
Full Length of Regenerating islet-derived protein 3-gamma 16.5 kDa form Chain
-
Synonyms
Regenerating islet-derived protein 3-gamma; REG-3-gamma; Pancreatitis-associated protein 3; Regenerating islet-derived protein III-gamma; Reg III-gamma; Regenerating islet-derived protein 3-gamma 16.5 kDa form; Regenerating islet-derived protein 3-gamma 1
-
AA Sequence
EVAKKDAPSSRSSCPKGSRAYGSYCYALFSVSKNWYDADMACQKRPSGHLVSVLSGAEASFLSSMIKSSGNSGQYVWIGLHDPTLGYEPNRGGWEWSNADVMNYINWETNPSSSSGNHCGTLSRASGFLKWRENYCNLELPYVCKFKA
-
Predicted Molecular Mass
18.3 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O . For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
