1. Recombinant Proteins
  2. Others
  3. REG1B Protein, Rhesus Macaque (HEK293, His)

REG1B Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived REG1B protein, expressed by HEK293, with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
무료 샘플   Apply now
5 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

REG1B Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived REG1B protein, expressed by HEK293, with C-His labeled tag.

Background

REG1B might act as an inhibitor of spontaneous calcium carbonate precipitation. It may also be associated with neuronal sprouting in the brain, as well as regeneration processes in both the brain and pancreas. by similar: The protein's function could involve inhibiting calcium salt deposition and playing a role in neural tissue repair.

Biological Activity

Measured in a cell proliferation assay using RT4-D6P2T rat schwannoma cells. The ED50 for this effect is 0.4012 μg/mL, corresponding to a specific activity is 2.492×103 units/mg.

Species

Rhesus Macaque

Source

HEK293

Tag

C-His

Accession

NP_001181497.1 (Q23-N166)

Gene ID
Molecular Construction
N-term
REG1B (Q23-N166)
Accession # NP_001181497.1
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Lithostathine-1-beta; PSP-2; REG-1-beta; PSPS2; REGL
AA Sequence

QETQTELPNARISCPEGTNAYRSYCYYFNEDPETWVDADLYCQNMNSGNLVSVLTEAEGAFVASLIKESSTDDSNVWIGLHDPKKNRRWHWSSGSLVSYKSWDIGAPSSANAGYCASLTSCSGFKKWKDESCEKKFSFVCKFKN

분자량

Approximately 17.7 kDa.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

REG1B Protein, Rhesus Macaque (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

REG1B Protein, Rhesus Macaque (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
REG1B Protein, Rhesus Macaque (HEK293, His)
Cat. No.:
HY-P77475
수량:
MCE Japan Authorized Agent: