REG4 Protein, Rat (HEK293, His)
Based on 1 Customer Validation
The REG4 protein is a calcium-dependent lectin that functions as a pattern recognition receptor (PRR) in the innate immune system. REG4 has specific affinity for α-mannan on Candida albicans hyphae and triggers phosphorylation of the FCER1G immunoreceptor tyrosine activation motif (ITAM), thereby activating SYK, CARD9 and NF-kappa-B. REG4 Protein, Rat (HEK293, His) is the recombinant rat-derived REG4 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The REG4 protein is a calcium-dependent lectin that functions as a pattern recognition receptor (PRR) in the innate immune system. REG4 has specific affinity for α-mannan on Candida albicans hyphae and triggers phosphorylation of the FCER1G immunoreceptor tyrosine activation motif (ITAM), thereby activating SYK, CARD9 and NF-kappa-B. REG4 Protein, Rat (HEK293, His) is the recombinant rat-derived REG4 protein, expressed by HEK293 , with C-His labeled tag.
Background
Dectin-2/CLEC6A, a calcium-dependent lectin, serves as a pattern recognition receptor (PRR) in the innate immune system, with a specific affinity for alpha-mannans present on C.albicans hyphae. Upon binding, this receptor complex triggers the phosphorylation of the immunoreceptor tyrosine-based activation motif (ITAM) of FCER1G, activating SYK, CARD9, and NF-kappa-B. This activation sequence leads to the maturation of antigen-presenting cells and shapes antigen-specific priming of T-cells towards effector T-helper 1 and T-helper 17 cell subtypes. Additionally, Dectin-2/CLEC6A recognizes allergens from house dust mite and fungi in a mannose-dependent manner, promoting cysteinyl leukotriene production. It also plays a role in altering adaptive immune responses by recognizing soluble elements from the eggs of Shistosoma mansoni. Associated with FCER1G, it forms a heterodimer with CLEC4D, creating a PRR against fungal infection.
Verified Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of HCT-116 human colorectal carcinoma cells under low serum conditions. The ED50 for this effect is 2.633 µg/mL, corresponding to a specific activity is 379.79 units/mg.
MCE Validation Data
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-6*His
-
Accession
Q68AX7 (D23-P157)
-
Molecular Construction
-
N-term
-
REG4 (D23-P157)
Accession # Q68AX7 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
REG4; Regenerating Islet-Derived Protein IV; Regenerating Family Member 4; Regenerating Islet-Derived Protein 4; RELP; Regenerating Gene Type IV; GISP; REG-Like Protein; Gastrointestinal Secretory Protein; Reg IV; REG-IV; REG-4; Regenerating Islet-Derived
-
AA Sequence
DILRPSCASGWFNYRSHCYGYFRKLRNWSHAELECQSYGNGSHLASVLNPKEASVISKYITGYQRSLPVWIGLHDPQKNASWQWIDGSTNQYRPWSPRTKSEARHCTEMNPKDKFLTWNKNGCTKRQHFLCKYRP
-
Molecular Weight
Approximately 26-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
