ROBO4 Protein, Mouse (HEK293, His)

ROBO4 protein, as a receptor for Slit proteins (especially SLIT2), plays a key role in angiogenesis and blood vessel pattern formation. It mediates the inhibition of primary endothelial cell migration by Slit protein and actively maintains endothelial barrier organization and function. ROBO4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ROBO4 protein, expressed by HEK293 , with C-His labeled tag.

ROBO4 Protein functions as a receptor for Slit proteins, particularly SLIT2, and plays a crucial role in angiogenesis and vascular patterning. This receptor is implicated in mediating the inhibition of primary endothelial cell migration by Slit proteins. Additionally, ROBO4 is actively involved in maintaining the organization and functionality of the endothelial barrier. Through its interactions with SLIT2 and ENAH, ROBO4 contributes to intricate cellular processes, shedding light on its significance in vascular development and the regulation of endothelial cell behavior.

Mouse

HEK293

C-8*His

Q8C310-1 (L28-W480)

74144  [NCBI]

Partial

LDSPPQILVHPQDQLLQGSGPAKMRCRSSGQPPPTIRWLLNGQPLSMATPDLHYLLPDGTLLLHRPSVQGRPQDDQNILSAILGVYTCEASNRLGTAVSRGARLSVAVLQEDFQIQPRDTVAVVGESLVLECGPPWGYPKPSVSWWKDGKPLVLQPGRRTVSGDSLMVSRAEKNDSGTYMCMATNNAGQRESRAARVSIQESQDHKEHLELLAVRIQLENVTLLNPEPVKGPKPGPSVWLSWKVSGPAAPAESYTALFRTQRSPRDQGSPWTEVLLRGLQSAKLGGLHWGQDYEFKVRPSSGRARGPDSNVLLLRLPEQVPSAPPQGVTLRSGNGSVFVSWAPPPAESHNGVIRGYQVWSLGNASLPAANWTVVGEQTQLEIATRLPGSYCVQVAAVTGAGAGELSTPVCLLLEQAMEQSARDPRKHVPWTLEQLRATLRRPEVIASSAVLLW

Approximately 60-70 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.