ROBO4 Protein, Mouse (HEK293, His)
ROBO4 protein, as a receptor for Slit proteins (especially SLIT2), plays a key role in angiogenesis and blood vessel pattern formation. It mediates the inhibition of primary endothelial cell migration by Slit protein and actively maintains endothelial barrier organization and function. ROBO4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ROBO4 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ROBO4 protein, as a receptor for Slit proteins (especially SLIT2), plays a key role in angiogenesis and blood vessel pattern formation. It mediates the inhibition of primary endothelial cell migration by Slit protein and actively maintains endothelial barrier organization and function. ROBO4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ROBO4 protein, expressed by HEK293 , with C-His labeled tag.
Background
ROBO4 Protein functions as a receptor for Slit proteins, particularly SLIT2, and plays a crucial role in angiogenesis and vascular patterning. This receptor is implicated in mediating the inhibition of primary endothelial cell migration by Slit proteins. Additionally, ROBO4 is actively involved in maintaining the organization and functionality of the endothelial barrier. Through its interactions with SLIT2 and ENAH, ROBO4 contributes to intricate cellular processes, shedding light on its significance in vascular development and the regulation of endothelial cell behavior.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-8*His
-
Accession
Q8C310-1 (L28-W480)
-
Molecular Construction
-
N-term
-
ROBO4 (L28-W480)
Accession # Q8C310-1 -
8*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
ROBO4; FLJ20798; Roundabout Guidance Receptor 4; Roundabout, Axon Guidance Receptor, Homolog 4 (Drosophila); Roundabout Homolog 4; Roundabout, Axon Guidance Receptor, Homolog 4; ECSM4; Roundabout Homolog 4, Magic Roundabout; MRB; Roundabout Homolog 4 (Dro
-
AA Sequence
LDSPPQILVHPQDQLLQGSGPAKMRCRSSGQPPPTIRWLLNGQPLSMATPDLHYLLPDGTLLLHRPSVQGRPQDDQNILSAILGVYTCEASNRLGTAVSRGARLSVAVLQEDFQIQPRDTVAVVGESLVLECGPPWGYPKPSVSWWKDGKPLVLQPGRRTVSGDSLMVSRAEKNDSGTYMCMATNNAGQRESRAARVSIQESQDHKEHLELLAVRIQLENVTLLNPEPVKGPKPGPSVWLSWKVSGPAAPAESYTALFRTQRSPRDQGSPWTEVLLRGLQSAKLGGLHWGQDYEFKVRPSSGRARGPDSNVLLLRLPEQVPSAPPQGVTLRSGNGSVFVSWAPPPAESHNGVIRGYQVWSLGNASLPAANWTVVGEQTQLEIATRLPGSYCVQVAAVTGAGAGELSTPVCLLLEQAMEQSARDPRKHVPWTLEQLRATLRRPEVIASSAVLLW
-
Predicted Molecular Mass
50.3 kDa
-
Molecular Weight
Approximately 60-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
