ROR2 Protein, Human (Inactive, sf9, His-GST)
The ROR2 protein is a tyrosine protein kinase receptor that plays a critical role in early chondrocyte formation and is essential for cartilage and growth plate development. Phosphorylated YWHAB induces osteogenesis and bone formation. ROR2, Human (Inactive, sf9, His-GST) is the recombinant human-derived ROR2 protein, expressed by sf9 insect cells, with N-His;N-GST labeled tag.
- Species: Human
- Source: sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Help & FAQs
Biological Activity
Description
The ROR2 protein is a tyrosine protein kinase receptor that plays a critical role in early chondrocyte formation and is essential for cartilage and growth plate development. Phosphorylated YWHAB induces osteogenesis and bone formation. ROR2, Human (Inactive, sf9, His-GST) is the recombinant human-derived ROR2 protein, expressed by sf9 insect cells, with N-His;N-GST labeled tag.
Background
ROR2 protein, a tyrosine-protein kinase receptor, emerges as a key player in the early stages of chondrocyte formation and is deemed essential for cartilage and growth plate development. Its phosphorylation of YWHAB not only induces osteogenesis but also promotes bone formation. Despite exhibiting minimal tyrosine kinase activity in vitro, ROR2's intricate role extends to potentially acting as a receptor for the Wnt ligand WNT5A. This interaction may lead to the intriguing outcome of inhibiting WNT3A-mediated signaling. The multifaceted functions of ROR2 highlight its significance in orchestrating complex processes such as chondrogenesis, osteogenesis, and the intricate regulation of Wnt signaling pathways.
Technical Parameters
-
Species Human
-
Source sf9 insect cells
-
Tag N-His;N-GST
-
Accession
Q01974 (M427-A943)
-
Gene ID4920
-
Molecular Construction
-
N-term
-
His-GST
-
(M427-A943)
Accession # Q01974 -
C-term
-
-
Protein Length
Cytoplasmic Domain
-
Synonyms
ROR2; Tyrosine-Protein Kinase Transmembrane Receptor ROR2; Prev. NTRKR2; Receptor Tyrosine Kinase-Like Orphan Receptor 2, Isoform CRA_b; Prev. BDB1; Neurotrophic Tyrosine Kinase, Receptor-Related 2; Prev. BDB; Neurotrophic Tyrosine Kinase Receptor-Related
-
AA Sequence
MCRNKQKASASTPQRRQLMASPSQDMEMPLINQHKQAKLKEISLSAVRFMEELGEDRFGKVYKGHLFGPAPGEQTQAVAIKTLKDKAEGPLREEFRHEAMLRARLQHPNVVCLLGVVTKDQPLSMIFSYCSHGDLHEFLVMRSPHSDVGSTDDDRTVKSALEPPDFVHLVAQIAAGMEYLSSHHVVHKDLATRNVLVYDKLNVKISDLGLFREVYAADYYKLLGNSLLPIRWMAPEAIMYGKFSIDSDIWSYGVVLWEVFSYGLQPYCGYSNQDVVEMIRNRQVLPCPDDCPAWVYALMIECWNEFPSRRPRFKDIHSRLRAWGNLSNYNSSAQTSGASNTTQTSSLSTSPVSNVSNARYVGPKQKAPPFPQPQFIPMKGQIRPMVPPPQLYVPVNGYQPVPAYGAYLPNFYPVQIPMQMAPQQVPPQMVPKPSSHHSGSGSTSTGYVTTAPSNTSMADRAALLSEGADDTQNAPEDGAQSTVQEAEEEEEGSVPETELLGDCDTLQVDEAQVQLEA
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipped with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
