S100A6 Protein, Human
The S100A6 protein is a key calcium sensor that actively promotes cellular calcium signaling and is involved in multiple processes, including actin cytoskeletal reorganization and cell motility. As a homodimer binding two calcium ions, it interacts with TPR-containing proteins, CACYBP, ANXA2, ANXA11, SUGT1, tropomyosin, TP53, PPP5C, and TPPP. S100A6, Human is the recombinant human-derived S100A6 protein, expressed by E. coli, with labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The S100A6 protein is a key calcium sensor that actively promotes cellular calcium signaling and is involved in multiple processes, including actin cytoskeletal reorganization and cell motility. As a homodimer binding two calcium ions, it interacts with TPR-containing proteins, CACYBP, ANXA2, ANXA11, SUGT1, tropomyosin, TP53, PPP5C, and TPPP. S100A6, Human is the recombinant human-derived S100A6 protein, expressed by E. coli, with labeled tag.
Background
The S100A6 Protein serves as a pivotal calcium sensor and modulator, actively contributing to cellular calcium signaling. Through interactions with various proteins, including TPR-containing proteins, S100A6 indirectly participates in diverse physiological processes, such as the reorganization of the actin cytoskeleton and cell motility. Existing as a homodimer with a head-to-tail assembly of two subunits, S100A6 binds two calcium ions in a cooperative manner. Its calcium-dependent interaction with CACYBP, ANXA2, ANXA11, SUGT1, and tropomyosin reveals its role in orchestrating complex molecular interactions. Moreover, S100A6 interacts with TP53, displaying higher affinity for TP53 phosphorylated on its N-terminal domain and lower affinity for TP53 phosphorylated on its C-terminal domain. The interaction with PPP5C, mediated by TPR repeats, is calcium-dependent and modulates PPP5C activity, emphasizing S100A6's regulatory influence in cellular processes. Additionally, its interaction with TPPP inhibits TPPP dimerization, as reported in recent studies.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
AAH01431/P06703 (M1-G90)
-
Gene ID6277
-
Protein Length
Full Length
-
Synonyms
S100A6; Protein S100-A6; Prev. CACY; S100 Calcium-Binding Protein A6 (Calcyclin); PRA; S100 Calcium-Binding Protein A6; Calcyclin; S100 Calcium-Binding Protein; CABP; Protein S100; 2A9; S10A6; Prolactin Receptor-Associated Protein; 5B10; Growth Factor-Ind
-
AA Sequence
MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
-
Predicted Molecular Mass
10.2 kDa
-
Molecular Weight
Approximately 10 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)