S100A8-S100A9 Heterodimer Protein, Mouse (His)
Based on 1 Customer Validation
S100A8, composed of calcium- and zinc-bound S100A8, plays a crucial regulatory role in inflammation and immune responses. As a calprotectin, it contributes to leukocyte function, regulates the cytoskeleton, and activates intracellular NADPH oxidase. The S100A8-S100A9 Heterodimer Protein, Mouse (His), is a recombinant protein dimer complex containing the S100A8-S100A9 heterodimer protein, expressed by E.coli and tagged with N-6*His.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
S100A8, composed of calcium- and zinc-bound S100A8, plays a crucial regulatory role in inflammation and immune responses. As a calprotectin, it contributes to leukocyte function, regulates the cytoskeleton, and activates intracellular NADPH oxidase. The S100A8-S100A9 Heterodimer Protein, Mouse (His), is a recombinant protein dimer complex containing the S100A8-S100A9 heterodimer protein, expressed by E.coli and tagged with N-6*His[1][2][3][4][5][6].
Background
S100A8, composed of calcium and zinc-bound S100A8, plays a crucial role in regulating inflammatory processes and immune responses. Normally existing as calprotectin (S100A8/A9), it possesses multiple intracellular functions, including promoting arachidonic acid transport and metabolism in leukocytes, regulating the tubulin-dependent cytoskeleton during phagocyte migration, and activating neutrophil NADPH oxidase. Extracellularly, it exhibits pro-inflammatory, antibacterial, oxidant-scavenging, and apoptosis-inducing activities. As an alarming or danger-associated molecular pattern (DAMP) molecule, S100A8 stimulates innate immune cells by binding to pattern recognition receptors such as Toll-like receptor 4 (TLR4) and the receptor for advanced glycation end products (AGER), thereby activating MAP kinase and the NF-kappa-B signaling pathway and amplifying the pro-inflammatory cascade. It possesses antibacterial activity against bacteria and fungi. Furthermore, S100A8/A9 induces cell death through autophagy and apoptosis, regulates neutrophil number and apoptosis, and acts as an oxidative scavenger to prevent tissue damage. In microbial infections (e.g., SARS-CoV-2), S100A8/A9 may induce the proliferation of abnormal immature neutrophils in a TLR4-dependent manner[1][2][3][4][5][6].
In Vitro
S100A8-S100A9 Heterodimer Protein, Mouse (1-20 μg/mL; 30 min) activates mouse platelets in a dose-dependent manner via GPIbα (CD36 acts as an auxiliary receptor), and induces P-selectin expression, GPIIb/IIIa activation and phosphatidylserine exposure on mouse platelets[3].
S100A8-S100A9 Heterodimer Protein, Mouse (1 μg/mL; 24 h) activates NF-κB pathway and upregulates multiple chemokines and pro-inflammatory cytokines in mouse primary cardiac fibroblasts, and promotes the migration of monocytes and cardiac fibroblasts through RAGE receptor; it has no influence on the proliferation and differentiation of mouse cardiac fibroblasts[4].
S100A8-S100A9 Heterodimer Protein, Mouse (0.2-5 μg/mL; 24 h) significantly increases the mRNA levels of MMP3, MMP9 and MMP13 in mouse bone marrow-derived macrophages[5].
S100A8-S100A9 Heterodimer Protein, Mouse expressed by mouse tumor cells activates intratumoral NK cells and inhibits tumor growth in vivo[6].
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
P27005 (P2-E89) (S100A8)&P31725 (A2-K113) (S100A9)
-
Gene ID20201 (S100A8) & 20202 (S100A9)
-
Synonyms
S100A8; MRP-8; Prev. CAGA; Urinary Stone Protein Band A; Prev. CFAG; Protein S100-A8; MRP8; Calgranulin A; P8; S100 Calcium-Binding Protein A8; Migration Inhibitory Factor-Related Protein 8; Calgranulin-A; Leukocyte L1 Complex Light Chain; CP-10; Calprote
-
AA Sequence
S100A8:
PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE
S100A9:
ANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK -
Predicted Molecular Mass
23.9 kDa
-
Molecular Weight
Approximately 11&13kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (265 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
