1. Recombinant Proteins
  2. Others
  3. S100A8-S100A9 Heterodimer Protein, Mouse (His)

S100A8-S100A9 Heterodimer Protein, Mouse (His)

Cat. No.: HY-P705438
Handling Instructions Technical Support

S100A8, composed of calcium- and zinc-bound S100A8, plays a crucial regulatory role in inflammation and immune responses. As a calprotectin, it contributes to leukocyte function, regulates the cytoskeleton, and activates intracellular NADPH oxidase. The S100A8-S100A9 Heterodimer Protein, Mouse (His), is a recombinant protein dimer complex containing the S100A8-S100A9 heterodimer protein, expressed by E.coli and tagged with N-6*His.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
10 μg 해외재고보유
20 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

S100A8, composed of calcium- and zinc-bound S100A8, plays a crucial regulatory role in inflammation and immune responses. As a calprotectin, it contributes to leukocyte function, regulates the cytoskeleton, and activates intracellular NADPH oxidase. The S100A8-S100A9 Heterodimer Protein, Mouse (His), is a recombinant protein dimer complex containing the S100A8-S100A9 heterodimer protein, expressed by E.coli and tagged with N-6*His[1][2][3][4][5][6].

Background

S100A8, composed of calcium and zinc-bound S100A8, plays a crucial role in regulating inflammatory processes and immune responses. Normally existing as calprotectin (S100A8/A9), it possesses multiple intracellular functions, including promoting arachidonic acid transport and metabolism in leukocytes, regulating the tubulin-dependent cytoskeleton during phagocyte migration, and activating neutrophil NADPH oxidase. Extracellularly, it exhibits pro-inflammatory, antibacterial, oxidant-scavenging, and apoptosis-inducing activities. As an alarming or danger-associated molecular pattern (DAMP) molecule, S100A8 stimulates innate immune cells by binding to pattern recognition receptors such as Toll-like receptor 4 (TLR4) and the receptor for advanced glycation end products (AGER), thereby activating MAP kinase and the NF-kappa-B signaling pathway and amplifying the pro-inflammatory cascade. It possesses antibacterial activity against bacteria and fungi. Furthermore, S100A8/A9 induces cell death through autophagy and apoptosis, regulates neutrophil number and apoptosis, and acts as an oxidative scavenger to prevent tissue damage. In microbial infections (e.g., SARS-CoV-2), S100A8/A9 may induce the proliferation of abnormal immature neutrophils in a TLR4-dependent manner[1][2][3][4][5][6].

In Vitro

S100A8-S100A9 Heterodimer Protein, Mouse (1-20 μg/mL; 30 min) activates mouse platelets in a dose-dependent manner via GPIbα (CD36 acts as an auxiliary receptor), and induces P-selectin expression, GPIIb/IIIa activation and phosphatidylserine exposure on mouse platelets[3].
S100A8-S100A9 Heterodimer Protein, Mouse (1 μg/mL; 24 h) activates NF-κB pathway and upregulates multiple chemokines and pro-inflammatory cytokines in mouse primary cardiac fibroblasts, and promotes the migration of monocytes and cardiac fibroblasts through RAGE receptor; it has no influence on the proliferation and differentiation of mouse cardiac fibroblasts[4].
S100A8-S100A9 Heterodimer Protein, Mouse (0.2-5 μg/mL; 24 h) significantly increases the mRNA levels of MMP3, MMP9 and MMP13 in mouse bone marrow-derived macrophages[5].
S100A8-S100A9 Heterodimer Protein, Mouse expressed by mouse tumor cells activates intratumoral NK cells and inhibits tumor growth in vivo[6].

Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

P27005 (P2-E89) (S100A8)&P31725 (A2-K113) (S100A9)

Gene ID

20201 (S100A8) & 20202 (S100A9)

Synonyms
S100A8-S100A9
AA Sequence

S100A8:
PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE
S100A9:
ANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK

Predicted Molecular Mass
11&12.9 kDa
분자량

Approximately 11&13kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 85%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
References

S100A8-S100A9 Heterodimer Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

S100A8-S100A9 Heterodimer Protein, Mouse (His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
S100A8-S100A9 Heterodimer Protein, Mouse (His)
Cat. No.:
HY-P705438
수량:
MCE Japan Authorized Agent: