S100A9 Protein, Mouse (His)

9 Cited Publications
Customer Review

Based on 9 publication(s) in Google Scholar

S100A9 Protein is a calcium- and zinc-binding protein which belongs to the S100 family that primarily expresses in neutrophils and monocytes.S100A9 can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2.S100A9 has pro-inflammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities which plays an important role in the regulation of inflammatory processes and immune response.S100A9 Protein, Mouse (His) is the recombinant mouse-derived S100A9 protein, expressed by E.coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

S100A9 Protein is a calcium- and zinc-binding protein which belongs to the S100 family that primarily expresses in neutrophils and monocytes.S100A9 can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2.S100A9 has pro-inflammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities which plays an important role in the regulation of inflammatory processes and immune response.S100A9 Protein, Mouse (His) is the recombinant mouse-derived S100A9 protein, expressed by E.coli , with N-6*His labeled tag.

Background

S100A9 is a calcium- and zinc-binding protein which belongs to the S100 family that primarily expresses in neutrophils and monocytes. S100A9 can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2 and can induce degranulation of neutrophils by a MAPK-dependent mechanism. S100A9 promotes leukocyte arachidonic acid transport and metabolism, tubulin-dependent cytoskeletal regulation during phagocyte migration and activation of the neutrophilic NADPH oxidase. S100A9 has pro-inflammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities.S100A9 acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to pattern recognition receptors and receptor for advanced glycation endproducts (AGER). S100A9 binds to TLR4 and AGER activates the MAP-kinase and NF-kappa-B signaling pathways, leading to amplification of the pro-inflammatory cascade. S100A9 has antimicrobial activity towards bacteria and fungi and exerts its antimicrobial activity probably via chelation of Zn2+ which is essential for microbial growth. S100A9 can regulate neutrophil number and apoptosis by an anti-apoptotic effect; regulates cell survival via ITGAM/ITGB and TLR4 and a signaling mechanism involving MEK-ERK. S100A9 plays an important role in the regulation of inflammatory processes and immune response[1][2][3][4][5][6][7].

Verified Bioactivity

Measured by its ability to induce CXCL1/KC secretion by C3H10T1/2 mouse embryonic fibroblast cells .The ED50 for this effect is ≤0.8299 μg/mL, corresponding to a specific activity is ≥1.20× 103 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to induce CXCL1/KC secretion by C3H10T1/2 mouse embryonic fibroblast cells. The ED50 for this effect is 0.4264 μg/mL, corresponding to a specific activity is 2.345 × 103 units/mg determined by ELISA.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to induce CXCL1/KC secretion by C3H10T1/2 mouse embryonic fibroblast cells. The ED50 for this effect is 0.8299 μg/mL, corresponding to a specific activity is 1.20× 103 units/mg determined by qRT-PCR.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • S100A9 (A2-K113)
      Accession # P31725
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    S100A9; 60B8AG; Prev. CAGB; CGLB; Prev. CFAG; MIF; MRP-14; NIF; MRP14; Protein S100-A9; P14; Calgranulin B; Migration Inhibitory Factor-Related Protein 14; S100 Calcium-Binding Protein A9 (Calgranulin B); Leukocyte L1 Complex Heavy Chain; S100 Calcium-Bin

  • AA Sequence

    ANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK

  • Predicted Molecular Mass

    13.7 kDa

  • Molecular Weight

    Approximately 14-16 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of sterile 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. The specifaction of 5/10/50/100/500/1000 μg is recommended to reconstitute to a concentration of200/200/500/500/2000/2000 μg/mL in sterilized water respectively. For concentration less than that, pleasereconstitute in 50 mM Tris-HCL, 300 mM NaCl, pH 7.4 buffer.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00