Copy Link Print Information

SARS-CoV-2 S1 Protein (HEK293, His)

Customer Review

Based on 1 Customer Validation

The SARS-Cov-2 S glycoprotein is a SARS-Cov-2 S glycoprotein. The amino acid sequence 1261-1267a.a of the SARS-Cov-2 S glycoprotein is transmembrane. The SARS-Cov-2 S glycoprotein is a highly glycosylated trimer, each of which consists of 1260 amino acids (residues 14-1273), divided into four structural domains: the n-terminal domain (NTD), the c-terminal domain (CTD, also known as the receptor-binding domain, RBD), and two subdomains (SD1 and SD2). SARS-CoV-2 S1 Protein (HEK293, His) is the recombinant Virus-derived SARS-CoV-2 S1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Virus
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • SARS-CoV-2 S1 Protein (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The SARS-Cov-2 S glycoprotein is a SARS-Cov-2 S glycoprotein. The amino acid sequence 1261-1267a.a of the SARS-Cov-2 S glycoprotein is transmembrane. The SARS-Cov-2 S glycoprotein is a highly glycosylated trimer, each of which consists of 1260 amino acids (residues 14-1273), divided into four structural domains: the n-terminal domain (NTD), the c-terminal domain (CTD, also known as the receptor-binding domain, RBD), and two subdomains (SD1 and SD2). SARS-CoV-2 S1 Protein (HEK293, His) is the recombinant Virus-derived SARS-CoV-2 S1 protein, expressed by HEK293 , with C-His labeled tag.

Background

SARS-Cov-2 is a enveloped positive-sense single-stranded RNA virus that causes COVID-19.
SARS-CoV-2 possesses four structural proteins, namely the envelope protein (E), spike or surface glycoprotein (S), membrane protein (M), and nucleocapsid protein (N).
The SARS-Cov-2 S glycoprotein is located on the exterior of the viral particle, giving the coronavirus its crown-like appearance.
The SARS-Cov-2 S glycoprotein can mediate the attachment and entry of viral particles into host cells and is an important target for vaccine development, antibody therapy, and antigen-based diagnostic esting[1][2][3][4][5].

Verified Bioactivity

1. Measured by its binding ability in a functional ELISA. Immobilized human ACE2 protein (Fc tag) at 2 μg/mL (100 μL/well) can bind SARS-CoV-2/2019-nCoV Spike Protein (S1 Subunit, His tag) , the EC50 of SARS-CoV-2/2019-nCoV Spike Protein (S1 Subunit, His tag) is 200-600 ng/mL.
2. Loaded ACE2 Protein, Human, Recombinant (mFc Tag) on AMC Biosensor, can bind SARS-CoV-2 (2019-nCoV) Spike S1-His Recombinant Protein with an affinity constant of 47.7 nM as determined by Octet RED System.

Technical Parameters

  • Species Virus
  • Source HEK293
  • Tag C-His
  • Accession

    YP_009724390.1 (V16-R685)

  • Gene ID
    43740568  [NCBI]
  • Molecular Construction
    • N-term
    • S1 Protein (V16-R685)
      Accession # YP_009724390.1
    • His
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    2019-nCov RBD Protein; 2019-nCoV Spike RBD Protein; S protein RBD; 2019-nCoV S protein RBD

  • AA Sequence

    VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR

  • Predicted Molecular Mass

    76.5 kDa

  • Molecular Weight

    Approximately 116 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • SARS-CoV-2 S1 Protein (HEK293, His) Product Image
    1/16
  • SARS-CoV-2 S1 Protein (HEK293, His) Product Image