2. Recombinant Proteins
  3. Viral Proteins
  4. SARS-CoV-2 Proteins
  5. SARS-CoV-2 Spike Proteins
  6. SARS-CoV-2 S1 Protein
  7. SARS-CoV-2 S1 Protein (HEK293, mFc)

SARS-CoV-2 S1 Protein (HEK293, mFc)

Cat. No.: HY-P7434
COA Handling Instructions

SARS-CoV-2 S1 Protein (HEK293, mFc) is the recombinant 2019-nCoV S1 protein with C-mFc tag produced in HEK293 cells.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
50 μg $195 In-stock
100 μg   Get quote  
or Bulk Inquiry

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

SARS-CoV-2 S1 Protein (HEK293, mFc) is the recombinant 2019-nCoV S1 protein with C-mFc tag produced in HEK293 cells[1].
Background

The spike (S) glycoprotein of SARS-CoV-2 is a main target for neutralization antibody, uses ACE2 to enter host cells. SARS-CoV-2 S glycoprotein harbors a furin cleavage site at the boundary between the S1/S2 subunits, which is processed during biogenesis and sets this virus apart from SARS-CoV and SARS-related CoVs[1].
Biological Activity

The ED50 is 0.19 μg/mL as measured by ELISA binding capcity to immobolized Human ACE-2, Fc.
Species

Virus
Source

HEK293
Tag

C-mFc
Accession

QHD43416.1 (Q14-R685)
Gene ID

43740568  [NCBI]
Molecular Construction
N-term
S1 Protein (Q14-R685)
Accession # QHD43416.1
mFc
C-term
Synonyms
2019-nCov RBD Protein; 2019-nCoV Spike RBD Protein; S protein RBD; 2019-nCoV S protein RBD
AA Sequence

QCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR

Molecular Weight

130-160 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Solution.
Formulation

Supplied as a 0.2 μm filter solution of PBS, pH 7.4.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping

Shipping with dry ice.
Documentation

COA (220 KB)

Handling Instructions (2659 KB)
References

SARS-CoV-2 S1 Protein (HEK293, mFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SARS-CoV-2 S1 Protein (HEK293, mFc)
Cat. No.:
HY-P7434
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.