SARS-CoV S Protein RBD (Biotinylated, HEK293, His-Avi)
The SARS-CoV S protein coordinates viral entry by interacting with human ACE2 and CLEC4M/DC-SIGNR receptors to attach viral particles to the cell membrane. It downregulates host tethering protein (BST2) through lysosomal degradation, antagonizing its antiviral activity. SARS-CoV S Protein RBD (Biotinylated, HEK293, His-Avi) is the recombinant Virus-derived SARS-CoV S protein RBD, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Virus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The SARS-CoV S protein coordinates viral entry by interacting with human ACE2 and CLEC4M/DC-SIGNR receptors to attach viral particles to the cell membrane. It downregulates host tethering protein (BST2) through lysosomal degradation, antagonizing its antiviral activity. SARS-CoV S Protein RBD (Biotinylated, HEK293, His-Avi) is the recombinant Virus-derived SARS-CoV S protein RBD, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
The SARS-CoV S protein is implicated in down-regulating host tetherin (BST2) through lysosomal degradation, thus counteracting its antiviral activity. In the context of infection, the S protein attaches the virion to the cell membrane by interacting with host receptors, initiating the viral entry process. The binding to human ACE2 and CLEC4M/DC-SIGNR receptors, coupled with the subsequent internalization of the virus into the endosomes of the host cell, induces conformational changes in the S glycoprotein. Additionally, proteolysis by cathepsin CTSL may unmask the fusion peptide of S2, activating membrane fusion within endosomes. These orchestrated events underscore the pivotal role of the SARS-CoV S protein in mediating viral entry and evading host antiviral defenses, shedding light on its significance in the pathogenesis of SARS-CoV infections. Further exploration is crucial to unveil the intricate molecular mechanisms underlying these processes and to identify potential targets for therapeutic interventions.
Technical Parameters
-
Species Virus
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
P59594 (R306-F527)
-
Gene ID1489668 [NCBI]
-
Molecular Construction
-
N-term
-
SARS-CoV S (R306-F527)
Accession # P59594 -
8*His-Avi
-
C-term
-
-
Protein Length
Full Length of Receptor-binding domain (RBD) Domain
-
Conjugation
Biotin
-
Synonyms
S protein RBD; S glycoprotein RBD; Spike protein RBD
-
AA Sequence
RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF
-
Predicted Molecular Mass
27.9 kDa
-
Molecular Weight
Approximately 36-46 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)