1. Recombinant Proteins
  2. Viral Proteins Biotinylated Proteins
  3. SARS-CoV S Protein RBD (Biotinylated, HEK293, His-Avi)

SARS-CoV S Protein RBD (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P78198
Handling Instructions Technical Support

The SARS-CoV S protein coordinates viral entry by interacting with human ACE2 and CLEC4M/DC-SIGNR receptors to attach viral particles to the cell membrane. It downregulates host tethering protein (BST2) through lysosomal degradation, antagonizing its antiviral activity. SARS-CoV S Protein RBD (Biotinylated, HEK293, His-Avi) is the recombinant Virus-derived SARS-CoV S protein RBD, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The SARS-CoV S protein coordinates viral entry by interacting with human ACE2 and CLEC4M/DC-SIGNR receptors to attach viral particles to the cell membrane. It downregulates host tethering protein (BST2) through lysosomal degradation, antagonizing its antiviral activity. SARS-CoV S Protein RBD (Biotinylated, HEK293, His-Avi) is the recombinant Virus-derived SARS-CoV S protein RBD, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

The SARS-CoV S protein is implicated in down-regulating host tetherin (BST2) through lysosomal degradation, thus counteracting its antiviral activity. In the context of infection, the S protein attaches the virion to the cell membrane by interacting with host receptors, initiating the viral entry process. The binding to human ACE2 and CLEC4M/DC-SIGNR receptors, coupled with the subsequent internalization of the virus into the endosomes of the host cell, induces conformational changes in the S glycoprotein. Additionally, proteolysis by cathepsin CTSL may unmask the fusion peptide of S2, activating membrane fusion within endosomes. These orchestrated events underscore the pivotal role of the SARS-CoV S protein in mediating viral entry and evading host antiviral defenses, shedding light on its significance in the pathogenesis of SARS-CoV infections. Further exploration is crucial to unveil the intricate molecular mechanisms underlying these processes and to identify potential targets for therapeutic interventions.

Species

Virus

Source

HEK293

Tag

C-Avi;C-8*His

Accession

P59594 (R306-F527)

Gene ID

1489668  [NCBI]

Molecular Construction
N-term
SARS-CoV S (R306-F527)
Accession # P59594
8*His-Avi
C-term
Protein Length

Partial

Conjugation

Biotin

Synonyms
S protein RBD; S glycoprotein RBD; Spike protein RBD
AA Sequence

RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF

Predicted Molecular Mass
27.9 kDa
Molecular Weight

Approximately 36-46 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

SARS-CoV S Protein RBD (Biotinylated, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SARS-CoV S Protein RBD (Biotinylated, HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SARS-CoV S Protein RBD (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P78198
Quantity:
MCE Japan Authorized Agent: