SARS-CoV S Protein RBD (sf9, His)
The SARS-CoV Spike glycoprotein (S) has three subunits S1, S2' and S2 through alternative splicing. S protein orchestrates viral entry by attaching the virion to the cell membrane through interactions with human ACE2 and CLEC4M/DC-SIGNR receptors. S protein also impairs target cell killing, cytokine production and down-regulates host tetherin (BST2), countering the antiviral activity of host. SARS-CoV S Protein RBD (sf9, His) is the recombinant Virus-derived SARS-CoV S protein RBD, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Virus
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The SARS-CoV Spike glycoprotein (S) has three subunits S1, S2' and S2 through alternative splicing. S protein orchestrates viral entry by attaching the virion to the cell membrane through interactions with human ACE2 and CLEC4M/DC-SIGNR receptors. S protein also impairs target cell killing, cytokine production and down-regulates host tetherin (BST2), countering the antiviral activity of host. SARS-CoV S Protein RBD (sf9, His) is the recombinant Virus-derived SARS-CoV S protein RBD, expressed by Sf9 insect cells , with C-His labeled tag.
Background
The SARS-CoV Spike glycoprotein (S) has three subunits S1, S2' and S2 through alternative splicing. S1 can attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. S2' acts as a viral fusion peptide which is unmasked following S2 cleavage occurring upon virus endocytosis. S2 mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein.
Under the current model, S protein has at least three conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes.
S protein orchestrates viral entry by attaching the virion to the cell membrane through interactions with human ACE2 and CLEC4M/DC-SIGNR receptors. It down-regulates host tetherin (BST2) via lysosomal degradation, countering its antiviral activity. Following attachment, internalization into host cell endosomes induces S glycoprotein conformational changes, potentially unmasking the fusion peptide of S2 through cathepsin CTSL proteolysis. S protein also impairs target cell killing and cytokine production[1][2].
Technical Parameters
-
Species Virus
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
AAX16192 (R306-F527)
-
Gene ID/
-
Molecular Construction
-
N-term
-
SARS-CoV S1 (R306-F527)
Accession # AAX16192 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
Spike glycoprotein; S glycoprotein; Peplomer protein; S
-
AA Sequence
RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF
-
Predicted Molecular Mass
26.5 kDa
-
Molecular Weight
Approximately 35 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)