SCP2 Protein, Human (GST)
SCP2 Protein, Human (GST) is the recombinant human-derived SCP2 protein, expressed by E. coli, with N-GST tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
SCP2 Protein, Human (GST) is the recombinant human-derived SCP2 protein, expressed by E. coli, with N-GST tag.
SCP2 plays a crucial role in the peroxisomal oxidation of branched-chain fatty acids (PubMed:10706581). It catalyzes the last step of the peroxisomal beta-oxidation of branched chain fatty acids and the side chain of the bile acid intermediates di- and trihydroxycoprostanic acids (DHCA and THCA) (PubMed:10706581). The enzyme is also active with medium and long straight chain 3-oxoacyl-CoAs. In vitro, it stimulates the microsomal conversion of 7-dehydrocholesterol to cholesterol and transfers phosphatidylcholine and 7-dehydrocholesterol between membranes (By similarity). The SCP2 and SCPx isoforms cooperate in peroxisomal oxidation of certain naturally occurring tetramethyl-branched fatty acyl-CoAs (By similarity).
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
P22307-2 (M1-L143)
-
Gene ID6342
-
Molecular Construction
-
N-term
-
GST
-
SCP2 (M1-L143)
Accession # P22307-2 -
C-term
-
-
Protein Length
Full Length of Isoform-2
-
Synonyms
SCP2; NsLTP; Sterol Carrier Protein 2; SCP-2; Acetyl-CoA C-Myristoyltransferase; SCPx; Propanoyl-CoA C-Acyltransferase; Epididymis Secretory Sperm Binding Protein; SCP-2/3-Oxoacyl-CoA Thiolase; Non-Specific Lipid Transfer Protein; SCP-2/Thiolase; Straight
-
AA Sequence
MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL
-
Predicted Molecular Mass
42.4 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
